KEGG   Pectobacterium wasabiae: Pecwa_1549Help
Entry
Pecwa_1549        CDS       T01106                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pwa  Pectobacterium wasabiae
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pwa00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1686582..1687103)
Genome map
AA seq 173 aa AA seqDB search
MTTLAIYHRPHITQPVQQLTAFNDIAALLASAGIQLEHWQTEAPPFGASSETILTQYHAD
IERLKQQEGYTSADVISLTPDHAERKALREKFLQEHTHSEDEVRFFVHGSGAFFVPIGEQ
VFQLTCEAGDLLRVPANTPHWFDCGEFPDFVAIRIFTNPEGWVGHFTGRETFH
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgacaacactcgcgatttaccaccgtccacacatcacacagcccgttcagcaactcacc
gcgtttaatgacatcgccgcactgcttgctagcgctggaattcagctagaacactggcag
accgaagcgcctccgttcggtgccagcagcgaaaccattttgacgcagtatcatgccgat
attgaacgtcttaagcagcaagaaggctacacctcagccgacgtgattagcctgacgcca
gaccacgcagagagaaaggcgctacgggaaaagtttcttcaggaacatacccatagcgaa
gatgaagtgcgcttttttgtgcatggtagcggcgcgtttttcgtgccgattggcgagcag
gttttccaactgacctgtgaagcaggcgatctcttacgcgtccctgccaacacgccgcac
tggtttgactgtggtgaatttcctgattttgtcgcgatccgcatttttaccaatccagaa
ggctgggttgggcactttaccggacgggagacgtttcactaa

DBGET integrated database retrieval system