KEGG   Pectobacterium wasabiae: Pecwa_1802Help
Entry
Pecwa_1802        CDS       T01106                                 

Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
pwa  Pectobacterium wasabiae
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pwa00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1956510..1957523
Genome map
AA seq 337 aa AA seqDB search
MHLARFPRLSLGHFPTPLEALPNLSAYLGGPTIYIKRDDATGLATGGNKTRKLEFLLADA
QQQGADVIITQGATQSNHVRQTIAAAAKLGLKTKVLLEKRVEDYGEDYQRSGNVLLDNLL
GGEIIDHLPAGTDMQQAMETLAASLRKDGFKPYVIPGGGSSPVGALGYVACAEELLFQSS
QQRLRIDHIVHATGSTGTQAGLVTGLAATHSQIPLLGISVRAPKAKQEENVYALAQRTWQ
LLGIPGELPRSAVQVNSDYVGKGYGIPTEGTLEALRLLAQLEGVLLDPVYSGKGMAGLID
LIRQGHFRTDENIVFIHTGGAAGLFGYRQLFEQTAVQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttgcccgattcccccgtttatcactgggccattttcctacgccgctggaggcg
ctaccgaacttgtctgcctatctgggcgggccgacgatttatatcaaacgcgacgatgca
accgggttggcaacgggtgggaataaaactcgcaagctggagttcctgttagccgatgcg
cagcagcagggcgcggatgtcattatcacgcagggcgcgacacagtctaaccatgtgcgg
caaaccattgcagcggcggcaaagttggggctgaaaaccaaggtgctgctggaaaagcgc
gtggaggactacggcgaagactaccagcgctccggcaacgtgctgctggataatctactg
ggcggtgagattatcgatcatctgcccgccggtacggatatgcagcaggcgatggaaacg
ctggcggcatcactgcgtaaagacggatttaagccttatgtcatccccggtggcggctcc
agcccggtaggcgcgttgggctatgttgcctgtgcggaagagctattgttccagtctagc
cagcagcgtctgcgtatcgatcacattgtccatgcaacgggcagcacgggaacgcaggcg
ggactggtgaccggactggcagcaacacacagccagattcctctactaggcatcagcgtc
agagcgcctaaagcaaagcaggaagagaatgtttacgcgttagcgcagcgcacctggcaa
ctgctggggatccccggcgaactgccgcgcagtgctgtgcaggtaaacagcgactacgtt
ggcaaaggctacggtattccgacagaaggaacgctggaagcgctcaggctgttggcgcag
ttggaaggagttttgctcgatccggtctattccggaaaggggatggcggggctgatcgat
ctgattcgtcaggggcattttcgcactgatgaaaatatcgtctttattcatacgggggga
gcggcggggttgtttggctaccgtcaactgttcgaacaaacggcagtacaatga

DBGET integrated database retrieval system