KEGG   Pectobacterium wasabiae: Pecwa_1859Help
Entry
Pecwa_1859        CDS       T01106                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pwa  Pectobacterium wasabiae
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pwa02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pwa02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2023343..2024395
Genome map
AA seq 350 aa AA seqDB search
MSKIRVLCVDDSALMRQIMTEIINSHPDMEVVATAPDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAIDFVTKPQLGIREGMLAYS
ELIAEKIRMAAKARLPQRSTAAEPTKIIQHMPLLSSEKLIAIGASTGGTEAIRHVLQPLP
PTSPALLITQHMPPGFTKSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGARHLELARS
GANYQVRLNDGPPVNRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGMLELHQAGA
YTLAQNEASCVVFGMPREAIAMGGVDEVVDLHQVSQRMLAQISAGQALRI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaataagagtattatgtgttgatgattctgccctgatgcgccagatcatgact
gaaataattaatagccatcccgatatggaagttgtcgcgaccgcaccagatccattagtt
gctcgtgatttgattaaaaaattcaatcctcaggtattaacactggatgttgaaatgccg
cgtatggatgggctggattttcttgaaaaacttatgcgtttgcgtccgatgcctgttgta
atggtgtcgtcgctgacgggaaagggttcagaaattacgcttcgcgcgctggaacttggt
gctattgattttgtcaccaaaccgcaactgggtatccgcgaagggatgctggcgtacagt
gaactgattgcagaaaaaattcgtatggctgcgaaagcgcgtttgccgcaacgtagcacc
gcagcagagccgacaaaaattattcagcatatgccactgctcagtagtgagaagctgatc
gcgattggtgcatccacgggggggacggaagcaatacgacatgtattacagcccctgccg
ccaacaagtcctgcgctattgattacacagcacatgccacctggctttacgaagtcattt
gctgagcgtttgaacaagctatgtcagattacggtgaaagaagcagaagacggggaacgt
gtgcttcctgggcatgcatacattgctcctggagctcgccatcttgaactggctcgtagt
ggggcaaactatcaagtacgtttaaatgatgggcctccagtgaatcggcatcgtccatca
gttgatgtgttattccgttcggttgcacaatacgccgggcggaatgccgtaggggtaatc
cttactgggatggggaatgatggggcggctggcatgttggaactccatcaggccggcgct
tatactctggcccaaaatgaagcaagttgtgtggtttttgggatgccacgtgaagcgatt
gctatgggtggcgttgatgaagtggtggatttgcaccaggtgagccagcgtatgttggca
caaatctctgccggacaggcattacgtatataa

DBGET integrated database retrieval system