KEGG   Pectobacterium parmentieri WPP163: Pecwa_1941Help
Entry
Pecwa_1941        CDS       T01106                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00790  Folate biosynthesis
pwa01100  Metabolic pathways
Module
pwa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pecwa_1941
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pecwa_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACX87721
JGI: Pecwa_1941
UniProt: D0KB35
Position
2108476..2109138
Genome map
AA seq 220 aa AA seqDB search
MSLLSKEAVMVHEALLARGLETPLRGALLDRDTRKQRIAEHMTEIMNLLSLDLSDDSLAE
TPTRIAKMYVDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDGVIGLSKLNRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcattattaagtaaagaagccgttatggtgcacgaagcgctgctggcacgcggtctg
gaaacgccgctgcgcggggcgttgttggatcgggatacgcgtaagcaacgtattgctgag
catatgacggaaattatgaatttgttgagtctcgatctgagcgatgacagtctggctgaa
acgccgacgcgtatcgccaaaatgtacgttgatgaaatattctccggtttggactacgcc
aactttcccaaaatcaccatcattgaaaacaaaatgaaggtcgatgaaatggtcaccgtg
cgggatatcacgctgaccagcacctgcgaacaccatttcgtgacgatcgatgggaaagcc
acggtcgcgtatattccgaaagatggcgtcattggtttatcgaaacttaaccgcatcgtc
cagtttttctcccagcgcccgcaggtgcaggagcgcttaacgcagcagattttggtcgcg
ttgcaaacgctgttgggaacgaacaacgttgccgtctcgattgatgctgtgcactactgc
gtgaaggcacgtggtattcgcgatgcaaccagtgccacgaccacgacatcgctcggcggg
ctgtttaaatccagccagaacacgcgtcaggaattcttgcgcgcggttcgccaccataat
taa

DBGET integrated database retrieval system