KEGG   Pectobacterium wasabiae: Pecwa_1941Help
Entry
Pecwa_1941        CDS       T01106                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pwa  Pectobacterium wasabiae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pecwa_1941 (folE)
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pecwa_1941 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2108476..2109138
Genome map
AA seq 220 aa AA seqDB search
MSLLSKEAVMVHEALLARGLETPLRGALLDRDTRKQRIAEHMTEIMNLLSLDLSDDSLAE
TPTRIAKMYVDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDGVIGLSKLNRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcattattaagtaaagaagccgttatggtgcacgaagcgctgctggcacgcggtctg
gaaacgccgctgcgcggggcgttgttggatcgggatacgcgtaagcaacgtattgctgag
catatgacggaaattatgaatttgttgagtctcgatctgagcgatgacagtctggctgaa
acgccgacgcgtatcgccaaaatgtacgttgatgaaatattctccggtttggactacgcc
aactttcccaaaatcaccatcattgaaaacaaaatgaaggtcgatgaaatggtcaccgtg
cgggatatcacgctgaccagcacctgcgaacaccatttcgtgacgatcgatgggaaagcc
acggtcgcgtatattccgaaagatggcgtcattggtttatcgaaacttaaccgcatcgtc
cagtttttctcccagcgcccgcaggtgcaggagcgcttaacgcagcagattttggtcgcg
ttgcaaacgctgttgggaacgaacaacgttgccgtctcgattgatgctgtgcactactgc
gtgaaggcacgtggtattcgcgatgcaaccagtgccacgaccacgacatcgctcggcggg
ctgtttaaatccagccagaacacgcgtcaggaattcttgcgcgcggttcgccaccataat
taa

DBGET integrated database retrieval system