KEGG   Pectobacterium wasabiae: Pecwa_2119Help
Entry
Pecwa_2119        CDS       T01106                                 

Definition
oligopeptidase B (EC:3.4.21.83)
Orthology
K01354  
oligopeptidase B [EC:3.4.21.83]
Organism
pwa  Pectobacterium wasabiae
Brite
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.83  oligopeptidase B
     Pecwa_2119
Peptidases [BR:pwa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Pecwa_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2311101..2313152
Genome map
AA seq 683 aa AA seqDB search
MKTPQAEKKPHTISTHGDTRVDNYYWLRDDQRTDPQVLSYLEQENAYSEAIMAPHAARKR
SLYDEMVKRIPSTDMSVPYVRKGYRYQSRYEPGKEYATYLRQPEQATEVWETLLDGNQRA
EGHEFYSLGALEISPNNTLLALSEDFLSRRQYTLRFRDLNSGEWLPDVIENVTAGAEWSA
DSTMLYYVRKHAQTLLPYQVYRHRLGSDPAQDELVYEEKDDTYYVSLSKTTSEHYITIYL
SSTTTTEVLLLDATLPEAVPQVGIPRRKDHEYGIDHYQGRFYLRSNREGKNFGLYHSDKP
DEQTLETLIAPREHRVLEGFELFRDWLVVEERERGLTSLRQIHWHTQEEKAITFNDASYV
TWLSYNPTPETALLRYGYSSMTTPSTLYELNLDTGEQQRLKQAEVKDFSPDHYRSERLWI
TVRDGVDVPVSLVYHREHFTPGKNPILVYGYGAYGSSMEPDFSVSRLSLLDRGFVFALTH
IRGGGELGQQWYDDGRLLNKMHSFTDFIDVSQALIEKGYGDRENMFAMGGSAGGLLMGAV
VNMAPDLFKGVVAQVPFVDVLTTMLDETIPLTTGEYDEWGDPNEQTYYDYIKQYSPYDGV
TAQSYPHLLVTTGLHDSQVQYWEPAKWVAKLRDVKTDDRLVLLYTDMDAGHGGKSGRFKR
YDDIALEYAFLLMVLEKAAEGHE
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccccgcaagctgaaaaaaagccccacacgataagcacacatggcgatacgcgt
gtcgacaactattactggttgcgtgatgaccagcgtaccgatccgcaggtgttgtcctat
ctggaacaggaaaatgcctacagtgaagcaatcatggcgcctcacgctgcacgtaaacgg
tcgctgtatgacgaaatggttaaacgtattccgtcgacggacatgtcggtaccgtatgtt
agaaagggttatcgctaccaaagtcgctatgagccgggcaaagagtacgctacctatctg
cgtcagcctgagcaggcaacagaagtatgggaaacgctattggatgggaatcaacgtgcg
gaggggcatgaattttatagtctcggcgcgcttgagattagcccgaacaatacgctattg
gccctctcggaggattttttatctcgccggcagtacacgctgcgttttcgcgatctgaac
agcggcgaatggctaccggatgtgatcgaaaatgtgaccgcaggtgcggaatggtcggca
gactcgacgatgctgtactacgtgcgtaaacatgcacaaacgctattgccgtatcaggtc
tatcgtcaccgccttgggagcgatccagcacaagatgaactggtatatgaagagaaagac
gacacctattatgtcagtctgagcaaaacgacatcagagcactacatcactatttatctc
agcagcactacgacgaccgaggtgttattactcgatgcgacgctcccagaggcggtgccg
caggtcggcattccacgtcggaaagatcatgaatatggcattgatcactatcaggggcgg
ttttacctgcgctctaaccgagaagggaaaaatttcggtctctaccattcggataaacct
gatgaacaaacgctggaaacgctaattgctccacgtgaacaccgcgttctggaaggtttc
gaactattccgtgattggctggtagtcgaagagagggaacgcggtttaaccagcttgcgc
cagattcactggcatacgcaggaagaaaaagcgatcactttcaatgacgcgagctatgtg
acgtggctatcgtataaccctacgccagaaacggcattgctgcgttatggctattcatca
atgacaacgcccagcacgctgtatgaattgaatctggatacgggtgaacagcaacggctt
aagcaagccgaagtgaaggatttctctccagatcattaccggagcgaacgcttgtggatc
acggtcagggacggcgtcgatgtccccgtttccctcgtttatcatcgcgagcatttcacc
cctggcaagaacccgatactggtttacggctatggcgcctatggaagtagcatggagccc
gatttcagcgttagccgcctgagcctgctggacagaggatttgtttttgccttaacgcat
attcgcggtggtggtgagctgggtcagcagtggtatgacgatggtcgattgctcaataaa
atgcattccttcacggatttcatcgatgtgtctcaggcattgatagaaaaaggctatggt
gacagggaaaacatgttcgctatggggggcagcgcgggagggctcttgatgggggcggta
gtcaatatggcccccgatttgttcaaaggtgttgtggcccaggttccgtttgttgatgtg
ttgacgacaatgctggatgagacaataccgctgacgaccggagagtatgacgagtggggc
gatccgaatgaacaaacctactatgactacatcaagcaatatagcccctatgacggtgtt
accgctcagagctatccacatttactggtgactaccgggttacatgactctcaggttcag
tattgggaacctgcgaagtgggtggcaaaattgcgggatgttaaaacagacgaccgtttg
gtgttgctgtacaccgatatggatgctgggcacggtgggaaatccggccgcttcaaacgc
tatgatgacattgcgctagagtatgcttttctattgatggtgcttgaaaaggctgcggaa
ggtcacgaataa

DBGET integrated database retrieval system