KEGG   Pectobacterium parmentieri WPP163: Pecwa_2281Help
Entry
Pecwa_2281        CDS       T01106                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00040  Pentose and glucuronate interconversions
pwa00052  Galactose metabolism
pwa00500  Starch and sucrose metabolism
pwa00520  Amino sugar and nucleotide sugar metabolism
pwa01100  Metabolic pathways
pwa01130  Biosynthesis of antibiotics
Module
pwa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pecwa_2281
   00052 Galactose metabolism
    Pecwa_2281
   00500 Starch and sucrose metabolism
    Pecwa_2281
   00520 Amino sugar and nucleotide sugar metabolism
    Pecwa_2281
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pecwa_2281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACX88051
JGI: Pecwa_2281
UniProt: D0KDQ5
Position
2469027..2469938
Genome map
AA seq 303 aa AA seqDB search
MSIVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEIQSICPKHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLKKDNLSEMLQRFSTTGHSQIMVEPVENVSSYGV
VDCKGVELKAGDSVPMVGVVEKPKASEAPSNLAVVGRYVLSADIWPLLEKTPPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHDGLGQEFAQWLQETIDA
EEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgtgaataaaaaagtaaaaaaagcggtcataccggttgctggattagggacg
cgtatgctgcctgccaccaaagccattcctaaagaaatgctgccgttggtagataaaccg
ctgattcaatatgttgttaatgagtgtatcgccgcaggaattaatgaaattattttggtt
acacactcatcgaagaattctattgaaaaccatttcgataccagttttgaactggaagcc
attttggaaaagcgtgttaaacgtcagctattggaggaaattcaatccatctgtcctaaa
cacgttaccattatgcaagtacgtcagggattagcgaaagggttgggccatgctgtattg
tgcgcgcacccgttagttggggatgagcctgtcgcggttattctgccggatgtgattatt
gatgaatatgaatccgatctgaagaaagataacctgagcgaaatgctgcagcgtttctct
actacaggtcacagccaaattatggttgagccagttgaaaatgtaagtagctacggtgtg
gttgattgcaaaggtgtggaattaaaagcaggggatagcgtccctatggttggcgtagtt
gagaaacctaaagcttccgaagcaccgtctaatttagccgtcgttggccgttatgtgctc
tctgctgatatttggccgctgctggagaaaacgccgccgggcgcaggtaatgaaattcag
ttgaccgatgccattgcgatgctgatggaaaaagaaacggtagaagcgtatcacctgaaa
ggtgtgagccatgactgtggtaataaactaggctatatgcaggcattcgtagaatatggt
ttacgccatgacgggttaggccaggagttcgcgcaatggttgcaggaaacgattgacgca
gaagaaaaataa

DBGET integrated database retrieval system