KEGG   Pectobacterium wasabiae: Pecwa_2281Help
Entry
Pecwa_2281        CDS       T01106                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pwa  Pectobacterium wasabiae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pecwa_2281
   00052 Galactose metabolism
    Pecwa_2281
   00500 Starch and sucrose metabolism
    Pecwa_2281
   00520 Amino sugar and nucleotide sugar metabolism
    Pecwa_2281
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pecwa_2281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2469027..2469938
Genome map
AA seq 303 aa AA seqDB search
MSIVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEIQSICPKHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLKKDNLSEMLQRFSTTGHSQIMVEPVENVSSYGV
VDCKGVELKAGDSVPMVGVVEKPKASEAPSNLAVVGRYVLSADIWPLLEKTPPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHDGLGQEFAQWLQETIDA
EEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgtgaataaaaaagtaaaaaaagcggtcataccggttgctggattagggacg
cgtatgctgcctgccaccaaagccattcctaaagaaatgctgccgttggtagataaaccg
ctgattcaatatgttgttaatgagtgtatcgccgcaggaattaatgaaattattttggtt
acacactcatcgaagaattctattgaaaaccatttcgataccagttttgaactggaagcc
attttggaaaagcgtgttaaacgtcagctattggaggaaattcaatccatctgtcctaaa
cacgttaccattatgcaagtacgtcagggattagcgaaagggttgggccatgctgtattg
tgcgcgcacccgttagttggggatgagcctgtcgcggttattctgccggatgtgattatt
gatgaatatgaatccgatctgaagaaagataacctgagcgaaatgctgcagcgtttctct
actacaggtcacagccaaattatggttgagccagttgaaaatgtaagtagctacggtgtg
gttgattgcaaaggtgtggaattaaaagcaggggatagcgtccctatggttggcgtagtt
gagaaacctaaagcttccgaagcaccgtctaatttagccgtcgttggccgttatgtgctc
tctgctgatatttggccgctgctggagaaaacgccgccgggcgcaggtaatgaaattcag
ttgaccgatgccattgcgatgctgatggaaaaagaaacggtagaagcgtatcacctgaaa
ggtgtgagccatgactgtggtaataaactaggctatatgcaggcattcgtagaatatggt
ttacgccatgacgggttaggccaggagttcgcgcaatggttgcaggaaacgattgacgca
gaagaaaaataa

DBGET integrated database retrieval system