KEGG   Pectobacterium parmentieri WPP163: Pecwa_2284Help
Entry
Pecwa_2284        CDS       T01106                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00010  Glycolysis / Gluconeogenesis
pwa00071  Fatty acid degradation
pwa00350  Tyrosine metabolism
pwa00620  Pyruvate metabolism
pwa00625  Chloroalkane and chloroalkene degradation
pwa00626  Naphthalene degradation
pwa00650  Butanoate metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_2284
   00620 Pyruvate metabolism
    Pecwa_2284
   00650 Butanoate metabolism
    Pecwa_2284
  Lipid metabolism
   00071 Fatty acid degradation
    Pecwa_2284
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pecwa_2284
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pecwa_2284
   00626 Naphthalene degradation
    Pecwa_2284
Enzymes [BR:pwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pecwa_2284
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Pecwa_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACX88054
JGI: Pecwa_2284
UniProt: D0KDQ8
Position
complement(2471615..2474293)
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVRKAQQEFATYTQEQVDKIFRAAALAASDARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYQDEKTCGILSTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDQPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSAYDAVRERFATHGGYMLKGKELHAVQGILLKNGSLNADIVGQP
APKIAEMAGITVPANTKVLIGEVTAVDESEPFAHEKLSPTLAMYRAKDFNDAVIKAEKLV
AMGGIGHTSCLYTDQDNQPERVNHFGNMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVASDGAK
RAFIVTDRFLFNNGYVDQVTSVLKHHGLETKVFFEVEADPTLSIVRKGAEQMHSFKPDVI
IALGGGSPMDAAKIMWVMYEHPTTHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHSLE
AYVSVLANEYSDGQALQALKLLKENLPDSYRDGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTTFSQYDRPQARRRYAEVAD
HLRLTAPSDRTAQKIEKLLNWLEEIKTELGIPTSIRDAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRKFSEDVKTEAIDPPVAKAAKTSKKAAH
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaccaacgttgctgaacttaacgcattggtcgaaagagtaagaaaggcacag
caggaatttgccacttacactcaggaacaagtagataagatcttccgcgctgctgcactc
gctgcatcggatgcccgtatcccactggcaaaaatggcagttgccgaatccggcatgggg
atagtggaagataaagtcatcaaaaaccacttcgcatccgaatacatttataacgcctat
caggatgaaaaaacctgcggcattctctctactgatgacactttcggtaccattaccatt
gcagagcctattggcctgatttgcggtattgttcccaccaccaaccctacttctaccgcg
atttttaaagcgctgatcagcctgaagacccgtaatggaattatcttctctcctcatccg
cgtgcaaaaaatgcgaccaataaagccgcagatatcgtgctgcaagcggcaattgccgca
ggcgcaccgaaagatatcattggctggattgaccagccttctgtcgagttgtctaaccaa
ctgatgcaccacccggatatcaacctgattctggctacgggtggcccaggtatggtgaag
gccgcgtacagttcaggtaaaccggcaatcggtgtaggtgccggtaacacccccgttgtc
gttgacgaaactgcagacatcaagcgtgccgtcgcctctattttgatgtcgaaaaccttc
gataacggtgtcatttgtgcgtccgagcagtctgtcatcgtggtagacagtgcctatgat
gccgtgcgtgagcgttttgctacccacggcggctacatgctgaaaggcaaagaacttcat
gccgtacagggaattctgctaaaaaacggttcactgaatgccgacattgtgggccaacca
gcaccgaaaattgcagaaatggcgggcatcaccgtcccagcaaacaccaaagtgctgatt
ggtgaggtaacagccgtcgatgaatccgaaccgtttgcccatgaaaaactttctccgaca
ctggcgatgtaccgtgcgaaagacttcaacgacgccgtcattaaagcggaaaaactggta
gcaatgggtggcatcggtcacacatcctgcctgtataccgatcaggacaatcagccagaa
cgcgtaaatcatttcggtaatatgatgaaaacggcgcgcatcctgattaatactcccgct
tctcagggcggtatcggcgatctctacaacttcaaactcgcgccgtctctgacgctgggc
tgcggctcctggggaggaaactccatctccgaaaacgtcggtccgaagcacttgatcaac
aagaaaacggtagccaagcgagcagagaatatgttgtggcataaacttcccaagtctatt
tatttccgtcgcggctcactgccaatcgcacttgaagaagtcgcctccgatggtgcaaaa
cgtgcatttatcgtgaccgaccgtttcctgttcaacaacggttacgtcgatcaagtcact
tccgtactgaaacatcacggactggaaaccaaggttttctttgaagttgaagctgatccg
acactgagcatcgtgcgtaaaggtgcagagcaaatgcactctttcaagccagatgtgatt
attgcgctgggcggaggttcgccaatggatgcggcgaagatcatgtgggtaatgtatgag
cacccgacgacgcatttcgaagagttggcactgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagccaaaatggtggcgataaccaccacatccggt
acgggttcagaggttacgccgtttgctgtggtgacggacgatgcaaccgggcagaaatat
ccgttagcagactatgcactgacgccagatatggcgattgttgatgccaacctggtgatg
aatatgccgaaatcactgtgtgcatttggtgggctcgatgccgtaacgcactcgctggaa
gcctatgtttccgtgctggcaaacgaatattcggacggccaggcgttacaagcgttgaaa
ttactaaaagagaatttgccagacagctaccgtgatggcgcaaaaaacccagtagcccgt
gagcgcgtgcataacgccgcaacgattgccggtatcgcgtttgccaacgccttcctcggc
gtctgtcactcaatggcgcacaagttgggctcggagttccatattccgcacggtctggcg
aacgccctactaatctcaaacgtgatccgctataacgcaaacgacaatccgaccaagcag
acgacgttcagccagtatgaccgccctcaggctcgccgtcgttacgcggaagtcgctgac
cacctgcgtttgactgccccaagcgatcgtaccgcgcagaaaatcgagaaattgctgaac
tggttggaagaaataaagactgagttggggatcccgacgtccatccgtgacgctggcgta
caggaagccgattttctggcgaaggtcgataagttgtctgaagatgcgttcgacgatcag
tgtactggcgctaacccgcgctatccactgatttccgaattgaagcaaattctgctggat
acttactatggtcgtaagttttctgaagacgtaaaaacagaagcgattgacccccccgta
gcaaaagccgccaaaaccagtaagaaagccgcacattaa

DBGET integrated database retrieval system