KEGG   Pectobacterium wasabiae: Pecwa_2301Help
Entry
Pecwa_2301        CDS       T01106                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pwa  Pectobacterium wasabiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pecwa_2301
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pecwa_2301
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pecwa_2301
Enzymes [BR:pwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pecwa_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2492460..2493266)
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFTRLAEKKEGAFVPFVTLGDPSPEQSLKIIDTLIAAGADALELGVPFSDPLAD
GPTIQAANLRAFAAGVTPEQCFEMLATIRQKYPEIPIGLLMYANLVFSNGIDEFYQRCAE
VGVDSVLVADVPVVESAPFRTAALRHGIAPIFICPPNADDELLREIASYGRGYTYLVSRA
GVTGAEKRAQLPLNHLVAKLNEYHAAPPLQGFGISDPTQVRETLASGAAGAISGSAIVRI
IEKNLNQPSLMLSELHTFVSEMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctaccaacagctatttacacgcctggcagagaaaaaagaaggcgcattcgtc
ccgtttgtcacactgggcgacccatcccctgagcagtcattgaaaattatcgatacgctg
attgccgccggtgccgatgcgctggaattaggcgtgcccttttctgacccgctggcggat
ggcccaaccattcaggcagctaatctgcgcgcttttgccgcaggcgtcacgccagagcaa
tgtttcgaaatgctggcgaccatccgtcagaaatacccggaaatccctattggtctgctg
atgtatgccaatctggtcttcagcaatggtatcgatgaattttatcagcgctgtgccgag
gttggcgtcgattcagttttagtggcggatgtcccagtggtagagtcggctcctttccgt
actgcagcactgcgacatggtattgcccctatctttatctgcccacccaatgctgatgac
gaactactgcgcgagatcgcctcttatggccgtggctatacctatctggtttcacgcgca
ggcgtgaccggagcagaaaagcgcgcccaactaccgctgaatcatctggttgccaaactg
aatgagtatcatgctgctccgccgctgcaagggtttggcatttccgatccgactcaagtg
cgggaaacattagcatcaggcgcagcgggggccatttctggttctgcgatcgtgcggatc
attgaaaaaaatctgaaccagcccagcctaatgctgtcagagttacatacctttgtgagt
gaaatgaaagcggctacgcgttcataa

DBGET integrated database retrieval system