KEGG   Pectobacterium wasabiae: Pecwa_2303Help
Entry
Pecwa_2303        CDS       T01106                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pwa  Pectobacterium wasabiae
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pwa01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pwa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2494473..2495840)
Genome map
AA seq 455 aa AA seqDB search
MQETVLHKIVRDKALWVAEREKAQPLASFQHEIVPSQRDFYQALKQDKPAFILECKKASP
SKGLIRDDFDPVAIAQVYKDYASAISVLTDEKYFQGDFAFLPQVSAAVHQPVLCKDFIIS
PYQIYLARYYQADAILLMLSVLDDEQYQQLAEVAHSLKLGVLTEVSNEEELQRAIQLEAR
VVGINNRDLRDLSIDLNRTRTLAPRLPAGVTVISESGINRHAQIRELSAFAQGFLIGSSL
MSEPDLNGAVRRVILGENKVCGLTRTEDAQAAYQAGALYGGLIFVASSPRYVAAKQAADI
ITGAPLRYVGVFRNAPMEHIVAITTQLGLAAVQLHGDEDQQTIDQLRQQLPAACQIWKAL
SIADVLPERNLTHIDRYVFDNGQGGSGQSFNWSLLDNQSLDNVLLAGGLNSDNCALAAQQ
GCAGLDFNSGVESEPGKKDSHKIAAVFATLRQPQH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtattacataaaattgtgcgtgataaagcactctgggttgctgaacgt
gagaaagcacagccgctggcctcttttcagcatgaaatcgtccccagccaacgtgacttt
tatcaggcactgaaacaggataagcccgcttttattctggaatgcaaaaaggcgtcgccg
tcaaaagggttgatccgcgacgattttgacccagtggccattgctcaggtctataaagat
tatgcgtctgccatttccgttttgaccgacgagaagtattttcagggcgacttcgccttt
ctgccgcaggtcagtgcggcagtacaccagccggtgttgtgcaaagacttcattatttca
ccctaccagatttatctggcgcgctactatcaagccgatgccattctgctgatgttgtcg
gtgctggacgacgagcaatatcagcaactggccgaggtagcacacagtctgaagctaggc
gtgttgacggaagtcagtaatgaagaggagctacagcgagccattcagcttgaagctcgc
gttgtcgggatcaacaaccgcgacctgcgcgatctctccattgacctcaaccgtacccgg
acgcttgcaccacgtctgccggctggcgtaaccgtgatcagtgaatctggtatcaaccgc
catgcgcagattcgtgaactcagcgcctttgctcagggattcttgatcggcagctcgctg
atgtccgagccagatctgaacggtgcggtacgccgcgttattctgggcgagaacaaagtt
tgtggtctgacgcgcacagaagatgcacaggccgcctatcaggctggtgcgctctacggc
gggttaatcttcgtcgccagctctccgcgctatgttgccgccaaacaagccgccgacatc
atcaccggagcaccactgcgctatgtcggtgttttccgcaacgcgcccatggaacacatc
gttgctatcacgacacagttgggattagcggccgttcagctacacggcgatgaagatcaa
cagactatcgaccagctacgccagcaattacctgcggcatgccagatttggaaagcgctg
agcatcgcagacgtgctgccagagcgtaatctcacccacatcgatcgttacgtgtttgac
aacggtcagggtggcagcggtcaatccttcaactggtcgctgttggacaatcagtcactg
gataacgtgctgttagccggtggcctaaacagcgataactgcgccctcgcggcacagcaa
ggttgcgcagggctggatttcaattccggggtagaaagcgaaccgggaaaaaaagactca
cataaaattgctgcggtttttgcgacattacgtcagccgcagcactaa

DBGET integrated database retrieval system