KEGG   Pectobacterium parmentieri WPP163: Pecwa_2410Help
Entry
Pecwa_2410        CDS       T01106                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00900  Terpenoid backbone biosynthesis
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01130  Biosynthesis of antibiotics
Module
pwa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pecwa_2410
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Pecwa_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACX88179
JGI: Pecwa_2410
UniProt: D0KEU0
Position
2615252..2616112
Genome map
AA seq 286 aa AA seqDB search
MQPTVTETWPAPAKLNLFLYITGQRQDGYHLLQTLFQFLDYGDTLTIRPRDDDQINLLTP
VNGVDNEQNLIVRAARLLQQHSDRPTYFGADISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQSGLSVDSLAELGLQLGADVPVFVRGHAAFAEGIGEQLTPANPPEKWYLVAHPGVSIA
TPLIFGDPELTRNSPIRDLESLLNQTFVNDCEAIARKRFREVEQLLSWLLEYAPARLTGT
GACVFAEFDTEFAARQVLDQAPEWLNGFVARGVNVSPLQRKLSGQR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgacggttaccgagacatggcctgcccccgccaaactgaatctatttctttat
attacgggccagagacaggacgggtatcacctgctgcaaacgctatttcagtttctggat
tacggcgacactctgacgattcggccgcgtgatgacgatcaaattaacctgcttaccccc
gtgaacggtgtcgataacgagcaaaacctgatcgttcgcgccgcacgcttactacagcag
cacagcgatcgccctacctattttggcgcagacatcagcatcgataagcgcctgccgatg
ggcggtgggctaggcggagggtcatccaatgcggccaccgtcttggtcgcccttaatcat
ttgtggcaaagcggcctgagcgttgattcgttggccgaattggggctacaactgggggcg
gatgttcccgtgtttgttcgtggacatgccgcctttgccgaaggtatcggcgaacagtta
acgccagcaaatccaccagaaaaatggtatctggtggcgcaccctggcgtgagtatcgcc
accccgttgattttcggcgatccggagttgacgcgaaattcgccaattcgtgatttagag
tctttattaaaccagaccttcgtcaatgattgtgaagctatcgcaagaaaacgttttcgt
gaggttgaacagctactttcatggctgctagaatacgccccggcgcgcctgactggaacg
ggggcttgtgtgtttgcagagtttgacaccgagttcgcagcccgtcaggtgcttgaccag
gccccggaatggttaaacggttttgtcgcgcgaggcgttaacgtctctccgctacaacgt
aagctttctgggcaacgttag

DBGET integrated database retrieval system