KEGG   Pectobacterium wasabiae: Pecwa_2612Help
Entry
Pecwa_2612        CDS       T01106                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pwa  Pectobacterium wasabiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pecwa_2612
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pecwa_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2852742..2854259)
Genome map
AA seq 505 aa AA seqDB search
MWLRRKQIVRKLTLGVVTTMLGMSLSFSALSATPVETHGQLSIENGRLVDEQGKRVQLRG
ISSNGLQWVGDYVNKDSMKWLRDDWGINVFRVAMYTAENGYIANPSLANKVKEAVAAAQG
LGVYIIIDWHTLSDNDPNTYKAQAKIFFAEMAGLYGNSPNVIYEIANEPNGSVTWNGQIR
PYALEVTDTIRSKDPDNLIIVGSGTWSQDIHDAADNQLPDPNTLYALHFYAGTHGQFLRD
RIDYAQSRGAAIFVSEWGTSDASGNGGPFLPESQTWIDFLNNRGISWVNWSLSDKSETSA
ALVAGASKSGGWTEQNLSTSGKFVREQIRAGAGLSGGDTPTMPTEPTNPGNGTTGDIVLQ
YRNVDNNPSDDAIRMAFNIKNTGSTPIKLSDLQVRYYFHDDGKPGANLFVDWANVGPNNI
VTSTGTPAASTDKANRYVLVTFASGAGSLQPGAETGEVQVRIHAGDWSNVNETNDYSYGP
NVTSYTNWDKITVHDKGTLVWGTEP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcagaaggaagcaaatcgtcaggaaattgacgctcggtgtagtaacaacgatg
ctgggcatgtcgctcagtttctccgcattatccgccaccccggtagaaacgcatggccag
ttgtccatcgaaaatgggcgattggtggatgaacagggaaagcgggtacaactaagaggg
atcagttcgaatggattgcagtgggttggtgactatgtcaacaaagattcgatgaaatgg
ctgcgtgacgattggggtataaatgtgttccgcgtcgctatgtacacggcggagaatggt
tatattgctaacccttctctcgccaataaagtaaaagaggccgttgcagcggcgcaaggc
ctcggtgtctatatcatcatcgattggcacaccttgtcggataacgatcccaatacttat
aaagcacaggcaaaaatcttctttgccgaaatggcggggctgtatggcaactcgccgaat
gtgatttatgaaatcgccaatgagccaaacggcagtgtgacatggaacgggcagattcga
ccttatgcgctggaagtcactgacaccatccgtagcaaagatcccgataaccttattatc
gtcggcagcgggacctggagccaggatatccatgatgcggcagacaatcagttgcccgat
ccgaatactctgtatgcgctgcatttctatgctggcacgcacgggcagttcctgcgcgat
cgcattgactatgcacaaagccgcggtgctgcaattttcgtcagcgagtggggaaccagc
gatgcgtccggcaatggcgggccgttcctgccagaatcgcagacctggatcgatttcctg
aataaccgtggtataagctgggtgaactggtcgcttagcgataagtctgagacatccgcg
gcgctggtagcgggcgcgagtaaatcaggcggctggacggagcagaatttgtcaacgtca
ggcaaatttgtcagagagcagattcgtgcgggggcgggtctgagcggtggtgatacgccg
acgatgccaacagagccgacgaacccaggtaacggaaccacgggtgacatcgtgctgcaa
tatcgtaatgtggataacaacccttccgatgatgcgattcgtatggcctttaatatcaaa
aataccggaagtacgccgatcaaactcagcgatctgcaagtacgttactacttccatgat
gatggtaagcccggcgcaaacctctttgttgactgggcgaacgtcggccctaacaacatc
gtgaccagtacagggacacctgctgcaagtaccgataaggccaatcgctatgttctggtg
actttcgccagcggcgcgggttcccttcaaccgggcgcggaaacaggtgaagtgcaggtg
cgtatccacgcgggtgactggagcaacgtgaatgagacgaatgactattcatacggccct
aacgtcacgagctacaccaactgggataagatcaccgtgcatgataaaggcacgctggtc
tggggcactgagccgtaa

DBGET integrated database retrieval system