KEGG   Pectobacterium wasabiae: Pecwa_3015Help
Entry
Pecwa_3015        CDS       T01106                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pwa  Pectobacterium wasabiae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pecwa_3015
   00052 Galactose metabolism
    Pecwa_3015
   00500 Starch and sucrose metabolism
    Pecwa_3015
   00520 Amino sugar and nucleotide sugar metabolism
    Pecwa_3015
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pecwa_3015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3283417..3284313)
Genome map
AA seq 298 aa AA seqDB search
MTSLKAIIPVAGLGMNLLPVTKAIPKEMLPLVDRPVIEKIVNECVRAGIKEIVLVTHASK
NAIENHFDTSFELESLLEERAKRQLLAEVQAICPKGVTIMNVRQGETLGLGHAVSCARPI
VGDNPFVVVLPDVVLDENSADQTQENLALLISRFEETGRSQVLVKHRPYEVLPEYSVVDC
EKPLANPGDAAAITSMIEKPEAPSETGSDLSAVGRYVLTADAWALLDKAAPGAWGRIQLT
DVIADMIATQKVDAVQMSGKNFNCGRKLGYAQAFVSYGLRNPEFGAEFKESIKALLKK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattgaaagcgattatccctgtagcaggtttagggatgaatttgttaccggtg
accaaggctattcctaaggaaatgttgcctctggttgaccgcccggtgatcgagaagatc
gtcaacgagtgcgtgagggcggggattaaagaaattgttctggttacacatgcgtctaaa
aacgcgatagaaaaccatttcgatacctcgtttgagcttgaatctttgttggaagaacgc
gctaagcgtcaacttctggccgaagttcaggccatctgtccgaaaggcgtgacgatcatg
aacgttcgtcagggagaaacgctgggattagggcatgcggtctcctgtgctcgtccaatt
gttggggataatccgtttgtggtggtgctgcccgatgttgtgttagatgaaaactccgcc
gatcagacacaggaaaatctggcgctgctgatttcccgttttgaagaaacggggcgcagc
caggtgctagtgaaacaccgaccttatgaggtgttgccggagtattctgtggttgattgt
gaaaagccgttggcgaacccaggcgatgctgctgcgattacgtcaatgatcgaaaaaccc
gaggcaccatccgaaacggggtctgatctttctgcagtagggcgctatgtattaaccgcc
gatgcttgggcattgctggataaagcggcccctggcgcatggggacgtattcagttaacg
gatgtgattgccgatatgatcgcaacccaaaaagttgatgctgtacagatgtcggggaaa
aactttaactgtggccgtaaattgggttacgcacaggcattcgtgtcctatgggttacgc
aatcccgagtttggtgccgaatttaaagaaagcattaaggcactgctgaaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system