KEGG   Pectobacterium parmentieri WPP163: Pecwa_3057Help
Entry
Pecwa_3057        CDS       T01106                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00010  Glycolysis / Gluconeogenesis
pwa00052  Galactose metabolism
pwa00500  Starch and sucrose metabolism
pwa00520  Amino sugar and nucleotide sugar metabolism
pwa00521  Streptomycin biosynthesis
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
Module
pwa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pwa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_3057
   00052 Galactose metabolism
    Pecwa_3057
   00500 Starch and sucrose metabolism
    Pecwa_3057
   00520 Amino sugar and nucleotide sugar metabolism
    Pecwa_3057
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pecwa_3057
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pecwa_3057
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pecwa_3057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACX88800
JGI: Pecwa_3057
UniProt: D0KI71
Position
complement(3332722..3333687)
Genome map
AA seq 321 aa AA seqDB search
MTHFVLVGDVGGTNTRLALCDAMTGELSQIETYSGLDFPSLEGAIRDYLDSRQATVQDAC
IAIACPITGDWVAMTNHTWAFSIAEMKASLGLRHFEVINDFTAVSMAVPVLGRESLLQFG
GGEPVPGKPVAVYGAGTGLGVAHLVHVANQWISLPGEGGHVDFAANSDEEDHILAILRQS
LGHVSAERLLSGQGLVNIYRAIVQFDDRRPEALEPKDITERAVNNTDVDCRRALSLFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFRASGFRAAFEDKGRFKSYMQDIPVYLIT
HEQPGLMGAGAYLRQVLGSAL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacgcactttgttctagtgggcgatgttggtggcaccaatacgcgtttggcgctgtgt
gacgccatgacaggcgaattgtcgcaaatcgaaacgtattctgggttggattttccttct
ctggaaggggcgatccgtgattatctcgattctcggcaggccacggtacaggatgcctgt
atcgcgattgcctgcccgattaccggtgactgggtggcgatgacgaatcacacctgggca
ttttccattgctgaaatgaaagcgagcctgggtttacgccattttgaggtcatcaacgat
tttactgctgtttccatggcggttccggtgctggggcgtgagagtttgctccagttcggt
ggcggggaaccggtgccgggtaagcccgtcgctgtgtatggtgcaggcactgggttaggt
gttgctcatctggttcatgttgccaatcaatggattagtctgccgggcgaaggcggacat
gtggatttcgcggccaatagcgatgaagaagaccacattctcgctattctgcgccaatca
ttaggacatgtttctgcggagcgcttgttgtccgggcaggggctggtaaatatttaccgt
gcgatcgtgcagtttgatgatcgcagaccggaggcgctggagccgaaggatattactgaa
cgggcggtcaataatacggatgtggattgtcgccgtgcgctatcgctcttctgcgtcatc
atggggcgcttcggtggcaatctggcgttaaatttaggtacatttggtggggtgtatatt
gctggcggcatcgtaccgcgttttctggagttttttagagcttctggctttcgcgcagct
tttgaagacaaagggcggtttaaaagctatatgcaggatatccccgtgtatttgattacc
catgaacagccgggattaatgggggcgggagcgtacctgcggcaggtgctgggcagcgca
ctgtaa

DBGET integrated database retrieval system