KEGG   Pectobacterium wasabiae: Pecwa_3076Help
Entry
Pecwa_3076        CDS       T01106                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pwa  Pectobacterium wasabiae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pecwa_3076 (gpmA)
   01230 Biosynthesis of amino acids
    Pecwa_3076 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_3076 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Pecwa_3076 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pecwa_3076 (gpmA)
Enzymes [BR:pwa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Pecwa_3076 (gpmA)
Exosome [BR:pwa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Pecwa_3076 (gpmA)
  Exosomal proteins of melanoma cells
   Pecwa_3076 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3354659..3355411
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRSEAKAAGQLLKDEGFAFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTRDDERFPGHDPRYAALSDKELPLTESLALTIERVVPYWTETILPRIKSGERVI
VAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctagtactggtaagacacggtgagagccagtggaacaacgaaaac
cgcttcacaggctggtacgatgttgatctgtccgacaagggccgttcagaagccaaagcc
gcaggtcaactgctgaaagacgaaggttttgcctttgatttcgcgtatacctccgtgctg
aaacgtgccattcatacactgtggaacgtactggacgagctggatcaagcctggttgcca
gttgagaaatcctggaaactgaacgagcgccattacggtgcgctgcagggtctgaacaaa
gccgaaaccgctgagaaatacggtgacgagcaggttaaacaatggcgtcgtggtttcgcc
attacgcctccagagttgacgcgtgatgacgaacgttttccaggccacgatccacgttat
gcagcgctgagtgacaaagagctaccgctgactgaaagcctggcgctgaccatcgaacgc
gttgtgccttactggaccgaaaccatcctgccacgcatcaagagcggtgagcgtgtgatc
gttgcggctcacggtaactcattgcgtgccctggtgaaatacctggacaacatgggtgaa
gacgaaattctggaactgaatatcccaactggcgtaccgttggtgtatgagttcgacgag
aacttcaaaccaatcaaacgttactatctgggcaacgcggatgaaatcgccgcaaaagct
gccgcagtagcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system