KEGG   Pectobacterium parmentieri WPP163: Pecwa_3098Help
Entry
Pecwa_3098        CDS       T01106                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00020  Citrate cycle (TCA cycle)
pwa00640  Propanoate metabolism
pwa00660  C5-Branched dibasic acid metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
Module
pwa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pwa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pecwa_3098
   00640 Propanoate metabolism
    Pecwa_3098
   00660 C5-Branched dibasic acid metabolism
    Pecwa_3098
Enzymes [BR:pwa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pecwa_3098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACX88840
JGI: Pecwa_3098
UniProt: D0KIP5
Position
complement(3375468..3376634)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVSNKEDIRAFAENWLGKKLVTYQTDAQGQPVHQILVEAATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQPYQGRELAFKLGLSGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDS
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGSPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVSVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTGAAQQVVAAVGDK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcaaaacaactctttgctcgatatggtttaccggcaccc
accggctatgcctgtacgacaccgcgtgaagcagaagaagccgcatctaagattggctcg
ggtccgtgggttgtaaaatgtcaggttcacgcaggcggtcgcggtaaagcgggcggcgtt
aaagtagtcagtaacaaagaagacattcgcgcttttgctgaaaactggctgggtaaaaag
ctcgttacttatcaaactgacgcacagggtcaaccggttcatcagattttggttgaagcc
gcaacggatatcgacaaagagctttatctgggcgcggttgttgaccgtggcacgcgtcgt
gtcgtgttcatggcgtccaccgaaggtggcgtagaaattgaaaaagtggcggaagagacg
ccggaactgatccacaaagctgctattgatccactggtaggtccacagccttatcagggc
cgcgagttggccttcaaactgggtttgagcggtaagcaagttgcgcaattcaccaaaatc
ttcatgggtctggcgacgctgttccttgagcgcgatctggcgctggtcgaaatcaacccg
ctggttatcaccaagcagggcgatctgatctgtctggatggcaagttgggcgcagacggt
aatgcactgttccgtcagcctgagctgcgtgaaatgcgtgacccaagccaggaagactct
cgtgaagcgcatgcagcccagtgggaactgaactatgttgcgctggacggcaacatcggc
tgtatggtgaacggtgccggtcttgcgatgggcaccatggacatcgtgaagctacacggc
ggttctcctgctaacttccttgatgtaggcggtggcgcaacgaaagaacgtgttactgaa
gcgttcaaaattatcctgtctgacgacaaggtaaaagccgtctttgttaacatctttggt
ggcatcgtgcgttgcgatttgatcgctgacggtatcatcggcgcggtagccgaagtgggc
gttagcgtgccggttgtggtacgtcttgaaggaaacaatgcggaactgggtgccaagaaa
ctggcggatagcggcctgaatattattgccgcgaccagcctgacgggtgcagctcagcag
gttgttgcagcagtgggggataaataa

DBGET integrated database retrieval system