KEGG   Pectobacterium parmentieri WPP163: Pecwa_3103Help
Entry
Pecwa_3103        CDS       T01106                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00020  Citrate cycle (TCA cycle)
pwa00190  Oxidative phosphorylation
pwa00650  Butanoate metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
Module
pwa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pwa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pwa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pecwa_3103
   00650 Butanoate metabolism
    Pecwa_3103
  Energy metabolism
   00190 Oxidative phosphorylation
    Pecwa_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACX88845
JGI: Pecwa_3103
UniProt: D0KIQ0
Position
complement(3383668..3384015)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLIRASAIVIVLYVIYIIGFIATAGDITYEIWRGFFAMALTKVF
TLLTLFSILVHAWIGMWQVLTDYIKPLALRLTLQLAIVVALLVYVIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttaggacgcaatggcgtacacgattggttactgattcgc
gcttccgccatcgtcattgttctatatgtaatttatattattggttttattgctacggct
ggcgacatcacttatgaaatctggcgtggtttcttcgcgatggccctcaccaaagtattc
acactgctaacgttattttccattctggttcatgcctggatagggatgtggcaagtgctg
accgactacattaaaccgctggccttacgcctgactttacagttggcaattgtggtagcg
ctgttggtgtacgtcatttatggaactgttgtggtgtggggtgcgtga

DBGET integrated database retrieval system