KEGG   Pectobacterium wasabiae: Pecwa_3193Help
Entry
Pecwa_3193        CDS       T01106                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pwa  Pectobacterium wasabiae
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pecwa_3193
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pecwa_3193
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pecwa_3193
Lipid biosynthesis proteins [BR:pwa01004]
 Fatty acid synthase
  Component type
   Pecwa_3193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3479400..3479993
Genome map
AA seq 197 aa AA seqDB search
MLLGLCSARAFAADTLLILGDSLSAGYQMPAANAWPTLLNTQWQTQKKGIAVVNASISGD
TTAQGLVRLPNLLKQHQPRWVLIELGGNDGLRGFPAQNIEQDLAKIITLVKQANAQPLLM
QVRLPTNYGRRYTESFSNIYPKLAEQFTLPLLPFFMEQVYLKPEWMMEDGIHPTRDAQPF
IAEWMAKQLEPLVNHES
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgcttctgggattatgcagcgcacgcgctttcgccgctgacacattattaattctgggc
gatagcctcagtgcgggctaccagatgccggccgctaacgcatggccaacgctgctgaac
acacagtggcaaacgcaaaaaaagggtatcgccgtggttaacgccagcattagtggtgac
accaccgcacaggggctggtgcgacttcctaacctgctgaaacagcatcagccacgctgg
gtgttgattgagctaggcggcaatgacggacttcggggatttccggcacaaaatatcgag
caggatctggcgaaaatcatcacgctggtcaaacaggctaacgctcaaccgctgctgatg
caggttcgtttgccgaccaactatggccgccgctacaccgagtcattcagcaatatctac
cccaaactggcagagcagtttacgcttcctcttctgcctttctttatggagcaagtgtat
cttaaaccggagtggatgatggaagatggcatccatccaacccgtgatgcccaaccgttt
atcgcagaatggatggcgaagcagttggagcccttagttaaccatgagtcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system