KEGG   Pectobacterium wasabiae: Pecwa_3861Help
Entry
Pecwa_3861        CDS       T01106                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pwa  Pectobacterium wasabiae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pecwa_3861
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pecwa_3861
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pecwa_3861
Enzymes [BR:pwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pecwa_3861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4263311..4264600)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGSQQGLFFPLELPEFERTEIDALLDLDFVTRSSRILS
AYIGDEIATETVFERVKAAFAFPAPIAPVEEDVAALELFHGPTLAFKDFGGRFMAQMLTE
VSGDEKITILTATSGDTGAAVAHAFYGLKNVRVVILYPQGKISPLQEKLFCTLGGNIHTI
AIDSDFDACQALVKKAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLSSGNWEPNKTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKTLGFGAVSDDTTKETMHQLDALGYVSEPHAAIAYRL
LRDQLQAGEFGLFLGTAHPAKFKESVEEILGKELDLPEALAERADLDLLSHYFPDDFAKL
REFLMSLPE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaagatcataacgagcaggtgagttttgctcaggctatcaag
caggggctgggcagccagcaggggctgttcttcccgttggagctgccagaatttgagcgc
accgaaatcgatgctctgctggatctggattttgtgacccgcagcagccgcattttgtct
gcctatatcggtgatgaaattgcgaccgaaaccgtgtttgagcgcgtaaaggcagccttt
gcgttccctgctcctatcgcgccagttgaggaagatgtcgctgcgctggagctgttccac
ggcccgacgctggcttttaaagacttcggcggccgctttatggcgcaaatgctgacagaa
gtctctggcgacgagaaaattaccattctgacggcgacctctggcgacaccggtgctgct
gtggcgcacgccttttacggcctgaaaaacgtccgtgtcgtgatcctgtatccgcagggc
aaaatcagcccgttgcaggaaaagttgttctgtacgctgggtggcaacattcacaccatt
gctatcgacagcgatttcgatgcctgtcaggcgttggtgaaaaaggcatttgacgatgaa
gaactgaaaaaggcgattggcctaaattcagcgaactccatcaacatcagccgcctgctg
gcgcaaatttgctactactttgaagcggttgcacaactgccgcaggaagcccgtaaccag
ttggtcgtttctgtaccgagcggtaacttcggcgatctgaccgcgggtctgttggcgaaa
tcactgggtctgccgattaagcgtttcattgcggcgactaacgccaatgacaccgtgccg
cgcttcctgagcagcgggaattgggaaccgaataaaacggtggcaacgttatccaacgcg
atggacgtaagtcagccgaacaactggccgcgcgtagaagagctgttccgtcgcaaaaac
tggcagttgaaaacgctgggctttggtgcggtgagtgatgacaccacgaaagaaaccatg
catcagttggatgcgttaggctatgtttcagaaccccatgcggcgattgcttatcgcttg
ctgcgcgatcagctacaagctggtgagtttggtctgttcctgggtacggcgcacccggcg
aaattcaaggaaagcgtagaagaaattctgggtaaagagctggatctgccggaagcgctg
gccgagcgtgccgatctggatctgctgtcgcactacttcccagatgatttcgcgaagctg
cgtgaattcctgatgtcgctgccggaataa

DBGET integrated database retrieval system