KEGG   Pectobacterium parmentieri WPP163: Pecwa_3957Help
Entry
Pecwa_3957        CDS       T01106                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00630  Glyoxylate and dicarboxylate metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01200  Carbon metabolism
Module
pwa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pecwa_3957
Enzymes [BR:pwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pecwa_3957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ACX89688
JGI: Pecwa_3957
UniProt: D0KAN2
Position
complement(4376658..4377965)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQVQHIEKEWKTARWEGITRPYSAEDVINLRGSVNPECTLAQLGAARLWNLLHG
ESRKGYVNCLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPA
VIERINNTFRRADQIQWANHIEPGDKRYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLASAKKCGHMGGKVLVSTQEAVQKLVAARLAADVLGVPTLLVARTDADAAD
LLTSDCDEYDRDFITGERTVEGFYRTRAGIEQAISRGLAYAPYADLVWCETSTPDLSLAR
RFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDSTIARFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMRHYVEKVQQPEFEAIKDGYTFSSHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctctcgtacccaacaagtccagcatatcgaaaaagagtggaaaaccgcccgc
tgggaaggtattacgcgcccctacagcgcagaagatgtgattaatctacgtggatcggtg
aacccggaatgcacactcgcacagctcggtgcggcgaggctatggaacctgctgcatggc
gaatcccgcaaaggctatgttaactgcctgggggcgctgacgggtgggcaagccttgcag
caggcgaaagccggcattgaggctatttacctttccggttggcaggtggcggcggatgcc
aatctggcgtccagcatgtatcccgatcagtcgctctacccagcaaattcggtgcctgcg
gtgatcgaacgcattaataacacgttccggcgtgccgatcagattcagtgggcgaatcac
attgagccgggtgataagcgctataccgattacttcctgccgattgttgcggatgcggag
gccggatttggcggtgtgcttaatgcgttcgagctgatgaagtcgatgattgaagcgggt
gcggcggcggttcactttgaagatcaactggcatcggcgaagaaatgcggacacatgggc
ggcaaggtactggtttccacgcaggaagccgttcagaagctggttgcggcccggctggca
gcggatgtcttgggcgtgccgaccttactggttgcgcgaactgatgcggatgcggcagat
ttactgacgtccgactgtgatgaatatgaccgtgatttcattaccggggaacgcacggtg
gaaggcttctatcgcacgcgtgcggggattgaacaggcgatcagccgtgggctggcctac
gcgccttatgcggatttagtgtggtgcgaaacctcgacgccggatttatcgctggcgcgt
cgttttgctgaggccatccacgcgaaatttcccggcaagctacttgcgtacaactgttcg
ccttcctttaactggaagaagaatctggatgacagcacgatcgcacgttttcaggatgag
ctgtcggcaatgggctacaagtatcagtttattacgctggctggcatccacagcatgtgg
ttcaacatgtttgacctggcgcatgcctatgcgcaaggtgaagggatgcggcactacgta
gaaaaagtacagcagcctgaattcgaggcgattaaagacggctataccttctcatcgcat
cagcaggaggtggggacaggttatttcgataaggtaacgaacatcattcagggaggcgag
tcttcagtgacggcgctgacgggatcgacggaagaacagcagttctga

DBGET integrated database retrieval system