KEGG   Pectobacterium parmentieri WPP163: Pecwa_3958Help
Entry
Pecwa_3958        CDS       T01106                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00620  Pyruvate metabolism
pwa00630  Glyoxylate and dicarboxylate metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01200  Carbon metabolism
Module
pwa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pecwa_3958
   00630 Glyoxylate and dicarboxylate metabolism
    Pecwa_3958
Enzymes [BR:pwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pecwa_3958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI TPR_7
Motif
Other DBs
NCBI-ProteinID: ACX89689
JGI: Pecwa_3958
UniProt: D0KAN3
Position
complement(4377997..4379595)
Genome map
AA seq 532 aa AA seqDB search
MMQQTINRELAFSQRFGEGEKHILTEEAVDFLAELVAHFTPARNQLLAERQVQQRNIDQG
KLPNFISETVSIRDKAWMIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFEDS
LSPGWEKVIDGQINLRDAVRGTISYINETGKIYQLKPNPAVLICRVRGLHLPEKHVSWQG
EAIPGSLFDFALYFFHNYQELLKKGSGPYFYLPKTQSWQEAAWWNDVFCYTEDRFDLPRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKSHSDRVLPDRQSV
TMEKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAERNNWVLDKVRKDKELEAHNGH
DGTWVAHPGLADAVMEVFDRALGERKNQLDISREQDAPIRAEELLEPCPGERTDIGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKTLSDGRVITKTLFRQ
MLAEEMFVIQEELGDARFSGGRFDEAARLMEQITTQDELIDFLTLPGYALLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcagacgataaacagagaattggcatttagtcagcgttttggcgaaggtgag
aagcacattcttactgaagaggcagttgatttcttagcggagttggtcgcacattttacg
ccagcacgtaatcaattacttgcggaacggcaggtgcagcagcgtaatatcgatcagggt
aagctaccaaattttatttcagaaacagtttccattcgagataaagcatggatgatacgt
ggtattcccgatgaccttcaggatcgccgtgttgaaattactggcccggttgaacgcaag
atggtgatcaacgcgttgaatgccaatgtgaaggtttttatggcggactttgaggattcg
ctgtcaccgggatgggaaaaggtgattgatgggcaaatcaacttgcgtgatgccgtgcgc
ggtacgatttcctacatcaatgaaacaggaaaaatttaccagttgaaacccaatcctgct
gtattaatttgccgggtacgcgggttgcatttgcctgaaaaacacgtgtcctggcagggg
gaagccattcccggcagcctgtttgatttcgcgctgtattttttccacaactatcaggaa
ttgttgaagaaaggtagtggtccttatttctatttgccaaagacacagtcatggcaggaa
gcggcctggtggaatgatgtcttctgctatacggaagatcgctttgaccttccgcgtggg
acgatcaaagcgacagtattgattgaaacactacctgccgttttccagatggacgaaatc
ctctaccacttacgcgatcatatcgtcgggttgaactgtggtcgttgggattatattttc
agttatatcaaaacattaaagagccacagcgatcgcgttctgcccgatcgtcagtcggtg
acgatggaaaaaccctttcttagtgcttactcgcggttgttaatcaaaacctgtcatcgg
cgcggtgcattcgccatgggtggaatggcagcgttcattccgagtaaggatgcggaacgc
aataactgggtgttggataaggtacgtaaagacaaagaactggaagctcacaatggtcac
gatggcacttgggtggctcatccggggctggcagatgccgtgatggaggtattcgatcgg
gcgttaggtgagcgtaaaaatcagctcgatatcagccgtgaacaggatgcgcctattcgc
gcagaggaactgctggaaccctgtccgggggagcgtacggacatcggtatgcgcgcgaat
atccgcgttgccgtgcagtacatcgaagcgtggatatctggtaatggttgcgtcccgatt
tatggattgatggaggacgcggcgacggcagaaatttcccgaacctcgatctggcagtgg
attcgtcatggtaagacgttgagcgatggtcgagtgatcaccaaaacgctgttccgccag
atgctggccgaagagatgtttgtgattcaggaagaattaggtgatgcccgttttagcgga
gggcgcttcgatgaggcagcccgactgatggagcaaatcactacgcaagatgaactgatc
gactttctgacgttacccggctacgcattgcttgattaa

DBGET integrated database retrieval system