KEGG   Pectobacterium wasabiae: Pecwa_4120Help
Entry
Pecwa_4120        CDS       T01106                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pwa  Pectobacterium wasabiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pecwa_4120 (malQ)
Enzymes [BR:pwa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pecwa_4120 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4535794..4537878)
Genome map
AA seq 694 aa AA seqDB search
MFKVDKLASQQTGIAESYTDAYGKKHIVAAAVRNRIQAMMDVSDSGNAPLPPVRVFLQGR
EAVIELAGHGEFFWTLMYENGGQIQGQITGGSTLALPGVLPLGYHYLTLTQADQRWSCRI
IVAPHRCYEPEALQQGKRWWGVTVQLYTLRSQNNWGVGDFGDLRQLVEQIARRGGAFVGL
NPLHSLYPALAEAASPYSPSSRHWLNIIYIDVNRIDDFQQSGEAQAWWHREETQSAIAAL
RAGRWVDYEPVTQLKLAALRLAFRYFTTRSALDPRISAFRQFVVSGGQSLQLQATFDALQ
TYLKKQGENYADWHQWPASYHDVHSETVKAFRRENSDEITFYSWLQWVAHEQLADCYAHS
KQLGLPLGLYRDLAVGVARGGAETWDERQLYCLDASIGAPPDPLGPQGQNWQLAPMNPTM
MQLRGYQPFIDVLRSNMAHCGALRIDHVMALLRLWWIPKAEPAGNGAYVHYPVDDLLAVL
ALESQRHRCLIIGEDLGTVPPEIVSKLHDYGIYSYKVLFFEKDAEDHFRPPEDYPRQAMA
TITTHDLPTLRGYWQTVDLSLGRELGLYPVEALLQEQMLQREKAKQGLLNALHHYGLLPQ
RVGRNSALTTMGAPLSRGVHRYVADSASALVGFQLEDWLDMATPVNVPGTNREYPNWRRK
LTRPLESIFADRCLERLVRDVDLRRGAPMKTQKA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggtggataaactggcaagccagcagaccggcatcgcggaaagctataccgat
gcctatggcaaaaagcacattgttgcggccgcagtcagaaaccggattcaggcaatgatg
gacgtttctgatagcggtaatgcgcccctgccgcctgttcgtgtcttcttgcaaggccga
gaggcggtcatcgagcttgctggtcacggtgaattcttctggacgctgatgtatgaaaac
ggcggtcaaattcaagggcagataaccggtggttcaacgctggctttgccgggcgtgctg
ccgctgggctaccactacctgacgttgacgcaggccgaccagcgctggagctgccggatt
attgttgcaccgcatcgctgctatgaacccgaagctttacagcagggaaaacgctggtgg
ggcgtgaccgtacagctttacaccttgcgttcgcagaacaattggggcgtaggggatttt
ggcgatctgcgccaactggtagaacagattgcccgacgcggtggcgcctttgtggggctg
aacccactgcattcgctgtacccggcgttggcagaggcggcgagcccttacagtccgtcg
tcccgccactggctgaatattatttatatcgatgttaatcggattgatgatttccaacag
agcggggaagcgcaggcgtggtggcatcgtgaggagacgcaaagtgcgatcgcagcgttg
cgggcggggcgctgggttgattatgagccggtgacgcagcttaagttagctgctctgcgg
ctggcgtttcgctattttacgacccgtagcgcgctggacccgcgcattagtgcatttcgt
cagtttgtcgtcagcggcgggcagagcctgcaacttcaggcgacgtttgatgcgttgcag
acctacctgaaaaaacagggcgagaattatgcggactggcatcaatggcctgccagttat
catgatgtacacagtgagaccgtaaaagcctttcgccgtgaaaacagcgatgagattaca
ttctacagttggctgcaatgggtggcgcatgagcaattagcagactgctacgcgcatagt
aaacagcttggtttaccgttaggtttatatcgcgatttggccgtcggggtcgcacggggc
ggcgcagaaacctgggacgaacgacagctatattgtctcgatgcttctatcggcgcaccg
cccgatccgctcgggccacagggacaaaactggcaacttgcgccgatgaaccccaccatg
atgcagcttcggggttatcaaccgtttatcgacgtgctgcgcagcaacatggcgcactgc
ggcgcgttgcgtatcgatcatgtaatggcgctcttgcgcctgtggtggataccgaaggcg
gagccagcgggcaacggggcctacgtgcattatccggtcgacgatctgctggcggtgctg
gcgctggaaagccagcgtcatcgctgcctgattatcggtgaggatttaggcacggtgccg
ccggaaattgtcagcaaactgcatgattacggtatctattcttacaaggtgctgttcttt
gaaaaggatgcagaggaccactttcgcccgcccgaggattacccgcgtcaggcgatggca
accattaccactcacgaccttccgacgctgcgcggctactggcaaaccgtggatttatcg
cttgggcgcgagttagggttgtatcctgtagaggcgttgttgcaagagcagatgctacag
cgtgaaaaagcgaaacaggggctgctcaacgcattacaccattacgggctgctgccacag
cgtgttggccgtaactcggcgctgacgacaatgggcgcaccgctgagccgtggcgttcac
cgctatgtcgccgatagcgccagcgcactggtcgggtttcaactggaagactggttggat
atggccacgccggtgaatgtaccgggcaccaaccgcgaataccctaactggcgacgcaag
ctgacgcgtccgctggaatcgatcttcgctgaccgctgccttgaacgactggttcgggat
gtggatttgcgccgcggtgcgccgatgaaaacacaaaaagcctaa

DBGET integrated database retrieval system