KEGG   Pectobacterium wasabiae: Pecwa_4142Help
Entry
Pecwa_4142        CDS       T01106                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pwa  Pectobacterium wasabiae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pwa00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pwa00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4564305..4566101
Genome map
AA seq 598 aa AA seqDB search
MNIKQKINQMTLEEKIGQKLMLDFRYWNSTGKSNQDMTIPDDAIGKLITDHHIGGVILFA
NNLKDKLQIKKLTAWYTAMETCGGVRLFISTDNEGGNVFRLPRGDYASFPGNMALSAAIE
GGADIQIASEQGRLMAQDMLFTHINTNFAPVVDVNTNPFNPVINVRAFSDDADTVYRVAE
KMTAGMKQQGLITAYKHFPGHGSTSTDSHTGLPRVDRSRKDAFAIDIMPYKRAIDSQTVP
DMVMTAHIQYPALDNSQVTTRNGEKITVPATMSYAIQTDILRGELGYAGVTISDALDMGA
IADHFSQEEAVRQVFTAGVDIALMPISISSPDQIKLLPDLIQHIVDMVKKGNIREAEIDA
SVERILTLKARYHLLCEKKPTIADTSSTRGYEVEKHIADRSITVVINQQSLLPLRDKTLR
YFILTPWGEQAKGIAAVMTQEGYLNVVAAKETELTDAQVRDHISNCDVFLLGTLSTRFTP
VEQDETATEKAKDGVANTPYPNWLRHAADLGKKRVHLSLRAPYDIISYAGDVNAAVATYS
YYGYDNGSWRGHSMISLAEVLTGKLAPQGKLPVNIWQNYDVETNTGTVAFSRGFGLSW
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaacagaaaataaaccaaatgacattagaagagaaaatcggacaaaaactc
atgctggattttcgctactggaattcaacgggaaaaagtaatcaggacatgacgattccc
gatgacgcgataggaaaattaatcacggatcaccatattggtggcgtgatcctatttgcc
aacaatctgaaagataagctgcaaattaaaaaactgacagcttggtataccgcgatggaa
acctgtggtggcgtccgattattcattagcacagataacgaagggggcaacgtttttcgc
ctaccacgcggcgattatgcatcatttcccggtaatatggcgctatccgcagcgattgaa
gggggggctgatatacagattgccagcgaacagggccgtctgatggcacaagacatgctt
tttacgcatatcaataccaactttgcaccggtcgttgatgtcaacaccaaccctttcaac
ccggtcattaacgtgcgtgctttcagcgacgacgcggacaccgtttatcgtgtggcggaa
aaaatgacggcaggcatgaaacagcaaggattgatcaccgcttacaagcattttccggga
cacggcagcacatctacggattctcacactggtctgcctcgtgtcgaccgctcacgaaaa
gacgcctttgccatcgatatcatgccttataagcgggctattgatagccagacggtgccg
gatatggtcatgacggctcatattcagtatccggcactggataactctcaggttactaca
cgtaacggtgagaaaattacggtgcctgcaaccatgtcatatgcgatccagactgatatc
ctgcgcggtgagttgggctatgctggtgtgacgatttcagatgcactggatatgggcgcg
attgccgatcatttcagtcaggaagaagccgttcgacaggtgttcaccgctggcgtggac
atagccctgatgcccatcagcatttcatctcccgatcagatcaaactcttgccagacttg
atccagcatattgtggacatggtgaagaaagggaacatcagagaagccgagattgatgcg
tcggtagagcgaattttaaccctcaaagcacggtatcaccttttatgtgagaaaaaacca
accatcgctgacacctcttctacacggggatacgaggtagaaaaacacattgccgatcgt
tccataactgtggtgatcaaccagcaatcactgctgccattaagagacaagaccctgcgc
tattttatcctgaccccctggggagagcaggccaaaggcattgcagccgttatgacacag
gagggatacctaaatgtggttgcagcaaaggaaacggaactgaccgatgcccaagtcaga
gatcatatttccaactgtgacgtatttcttctcggaacgttgtcaacccgctttacacca
gttgagcaggatgaaactgccactgaaaaagcaaaggacggggtcgcgaataccccctac
ccgaactggttacgacatgctgccgatctggggaaaaagcgcgttcacctttcactacgc
gcaccgtatgacattatcagctacgctggtgacgttaacgctgctgtggcgacatattcc
tattacgggtatgacaacggtagttggcgtggtcactcgatgatatctttggcagaggtg
ctgacaggtaagctcgcgccacaggggaagctcccggtcaatatctggcaaaactacgat
gtggagacgaataccggtacggtggcattttctagagggtttgggctgagctggtaa

DBGET integrated database retrieval system