KEGG   Pectobacterium parmentieri WPP163: Pecwa_4172Help
Entry
Pecwa_4172        CDS       T01106                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pecwa_4172
Enzymes [BR:pwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pecwa_4172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4597404..4598144
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPTGEQLVTRLRKLGYHAWHSPLIEFSPGRELAGLPAQLQALHTDDLVFALS
QHAIHYADPMLTRTGTSWPAHLAYYAIGRTTALALHKISAHPVAYPPERETSETLLQLPE
LQDVAGKRALLLRGNGGRELLGETLTERGAQVTYCECYQRRDVHYDGSEQSRHWQQIGID
KLVITSGEMLQRIYTLVPDYYRASWLLGCQLIVVSERLAEQARQLGWHDIRVADNADNDA
LVRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggttacccgtccgtcacccactggcgaacaactggtgacccgtttaaga
aagctcggctaccacgcctggcacagcccgctgatcgagttttcgcctggacgagaactc
gctggtctgcctgcgcaattacaagccctacacaccgacgacctggtgtttgcgctctca
caacacgcgattcattacgccgatcccatgctgacgcgcacgggcacaagctggcctgcc
cacctcgcttattatgccattggccgcacgacggcactggctttacataaaatcagcgca
caccctgtcgcctatccgcctgaacgtgaaaccagcgaaacgctattgcaacttcctgag
ttacaagatgttgcagggaaacgagcgctattactgcgcggcaacggcggaagggagcta
ctgggtgaaacgttgactgagcggggcgcacaggtaacctactgtgaatgctatcagcgc
cgagatgttcactatgatggctcggaacaaagccgccactggcagcaaataggcatcgac
aaactggtgattaccagcggagaaatgctacaacggatctatactttagtacctgattac
tatcgggcttcctggttacttggctgccagttgatcgtcgttagcgaacgactggcagaa
caagcgcgtcagctcggctggcatgatatccgggtggccgataacgctgataacgatgcg
ctcgtgcgcgcactacaataa

DBGET integrated database retrieval system