KEGG   Pectobacterium parmentieri WPP163: Pecwa_4492Help
Entry
Pecwa_4492        CDS       T01106                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pecwa_4492
Enzymes [BR:pwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Pecwa_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4927691..4928314
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVEVD
EFKRMIQDNEFLEHAEVFGNYYGTSRPAIEQVLATGVDVFLDIDWQGAKQIRAQMPLARS
IFILPPSKEELARRLRGRGQDSDEVIARRMSQAVAEMTHYGEYDYLIVNDDFDLALLDLK
TIIRAERLRLSRQQVRHDALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgttatatatcgtttctgctcccagtggagccgggaaatccagcctg
attcaggcgttattaaaaactcaaccgctttacgacacgcaggtatcgatttcgcatacc
acgcgggcaaaacgaccgggagaaaaccacggcgagcactacttcttcgtcgaagtcgat
gaatttaagcgtatgattcaggataacgagtttctggaacacgctgaagtcttcggtaat
tactacggtacatcccgaccggcaattgagcaggtattagcaacaggcgttgatgtattt
ctggatatcgactggcaaggtgccaagcaaatccgcgcccaaatgccgctcgcgcgcagt
atttttattctgccgccgtctaaagaagaactcgctcgccgcctacgtggccgtggacaa
gacagcgatgaagtcattgctcgtcgtatgtcgcaagctgtggctgaaatgacgcactac
ggcgagtatgattacctgattgtgaatgatgatttcgatctggcgctgctcgatctgaaa
accattattcgcgccgaacgtctgcgtttgagcagacaacaggttcggcatgatgcatta
atcaccaaactattggcagactga

DBGET integrated database retrieval system