KEGG   Pyrus x bretschneideri (Chinese white pear): 103935817Help
Entry
103935817         CDS       T03446                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103935817
   00500 Starch and sucrose metabolism
    103935817
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103935817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 681 aa AA seqDB search
MADPRPFLPSDPDALPYTYTPLPNPDEASEIRKRQFKELLAVFSGLLMLSLLVVIISSGN
NSDSHANKNEPVFLAKEPYTTRPAKLRPVSRGIAAGVSEKSNRLADAVDGPAFPWNNSML
SWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQWNPNGAVWGDIVWGHAVSKDLIHWLH
LPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPADHNDPLLTKW
VKYSGNPILVPPPGIGYKDFRDPTTAWYTSQGKWRITIGSKLNKTGISLVYDTKDFKTYE
QLNGVLHAVPGTGMWECVDFYPVSKTSDKGLDTSVNGPDVKHVVKASLDDDRNDYYSLGS
YEEKTGKWVPDNQKIDVGIGIRYDYGIFYASKTFYDQNKERRVLWGWIGESDSENADMQK
GWASVQGIPRTVVFDKKTGSNLIQWPVEEVEKLRLSITDFDKVEVKAGSVLPLQVVTATQ
LDIVAEFELDKKVLESVAESNEVFSCNTSAGGSHRGALGPFGLLVLADETLSEQTPVYFY
VAKGPGGNFDTFFCADQTRSSVANDVKKKVTGSYVPVLKDEKLSVRILVDHSIVESFAQG
GRTTITTRVYPTKAIYGAARLFLFNNATEISVTASLKVWQMNSAFIRPYHPDETSNASLN
LVTYIKFIVIFFIFLTLSFLT
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccctagaccttttcttccatcggatcccgatgccctgccgtacacctacact
cctctcccgaatccggacgaagcttcggaaatccgaaagaggcagtttaaggagctccta
gcagtcttttctgggttgctgatgctttctttgttggtggtcattattagtagtggcaac
aattctgattcccatgcaaataaaaatgagccagtgtttttggctaaagagccttataca
acaaggcccgccaaactgcgcccggtttctcggggcatagcagccggagtgtccgagaag
tcgaatcggttggccgatgctgtggacgggccggcatttccatggaacaatagcatgctg
tcatggcagagaactgctttccatttccagcctgagaagaactggatgaatgatccaaat
ggtccattattctacaaaggttggtaccactttttctaccagtggaatcccaacggtgca
gtatggggagacattgtatggggccatgcagtgtccaaggacttgatccattggcttcac
ctccctctagccatggtggctgaccagtggtacgacatcaatggagtctggactggctca
gccaccattctccctgatggcaaaattgtcatgctctacactggctcaaccaatgagtcg
gtccaagtccaaaaccttgcatatcctgctgaccacaatgaccctctcctcaccaaatgg
gtcaagtactccggcaacccgattctagtcccgcccccgggcatcggatacaaggacttc
cgtgacccgacaactgcttggtacacgtcccaaggcaaatggcgcattactattgggtcc
aagcttaacaaaacaggcatatccttggtttatgataccaaggacttcaaaacctatgag
caattgaatggggtgcttcatgctgtccctgggactggaatgtgggagtgtgtggatttt
tatccggtgtcgaaaaccagtgacaaaggactggatacttcggtgaatgggcctgatgtg
aagcatgtggtgaaggctagtcttgatgatgataggaatgattactattcattggggtcc
tatgaggaaaagactggcaaatgggttcctgataaccaaaagattgatgttggtattgga
attcggtatgattatggcattttctatgcctccaagactttctatgaccaaaacaaggag
aggagagttttgtggggttggattggagagtctgatagtgaaaatgctgatatgcagaag
ggatgggcctccgttcagggaattccaaggacagtggtgtttgataagaagactggaagc
aatctaattcaatggccagtggaggaggtcgagaaattgagattgagcattacggacttc
gacaaggttgaggtcaaggcaggctcagtgctgccacttcaagttgtcacagccacacag
ttggacattgttgctgagttcgagttggacaagaaggttttggagagcgtagctgaatct
aatgaggtgttcagttgcaacaccagcgctggaggttcccatcgtggtgctttaggaccc
tttggtcttcttgttcttgcagatgagaccctctcagagcagactcctgtctacttttat
gtagccaaagggcctggtggcaattttgatactttcttttgcgccgatcaaacaaggtct
tctgtggctaatgatgttaagaaaaaagttactggcagctatgttccagttctaaaagat
gaaaaattatcagtgaggattctggttgaccattcgatcgtcgaaagctttgctcaaggt
ggaagaacaaccatcacaactagggtttacccaaccaaggcaatttatggggctgctagg
ctatttttgttcaacaatgctaccgagatcagtgttactgcctccctcaaagtatggcag
atgaactctgcatttatccgtccgtaccatccggacgaaacgagcaacgcaagcttaaac
cttgttacctacatcaaattcattgtcatattctttatttttttaactttatcttttctt
acatag

DBGET integrated database retrieval system