KEGG   Pyrus x bretschneideri (Chinese white pear): 103941840Help
Entry
103941840         CDS       T03446                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00052  Galactose metabolism
pxb00500  Starch and sucrose metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103941840
   00500 Starch and sucrose metabolism
    103941840
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103941840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 103941840
NCBI-ProteinID: XP_009350311
Position
Unknown
AA seq 680 aa AA seqDB search
MADPRPFLPSDPDALPYTYTPLPNPDEASEIRKRQFKELLAVFSGLLMLSLLVVIISSGN
NSDSHANKNEPVFSAKEPYTTRPAKLRPVSRGIAAGVSEKSNRLADAVDGPAFPWNNSML
SWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQWNPNGAVWGDIVWGHAVSKDLIHWLH
LPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPADHNDPLLTKW
VKYSGNPILVPPPGVGYKDFRDPTTAWYTSQGKWRITIGSKLNKTGISLVYDTKDFKTYE
QLNGVLHAVPGTGMWECVDFYPVSKTSDKGLDTSVNGPDVKHVVKASLDDDRNDYYSLGS
YEEKTGKWVPDNQKIDVGIGIRYDYGIFYASKTFYDQNKERRVLWGWIGESDSENADMQK
GWASVQGIPRTVVFDKKTGSNLLQWPVEEVEKLRLSITDFDKVEVKAGSVLPLQVVTATQ
LDIVAEFELDKKVLESVAESNEVFSCNTSAGGSHRGALGPFGLLVLADETLSEQTPVYFY
VAKGPGGNFDTFFCADQTRSSVANDVKKKVTGSYVPVLKDEKLSVRILVDHSIVESFAQG
GRTTITTRVYPTKAIYGAARLFLFNNATDTSVTASLKVWQMNSAFIRPYHPDETSNASSN
LVTYLKFIVTFFIFLTFIFS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccctagaccttttcttccatcggatcccgatgccctgccgtacacctacact
cctctcccgaatccggacgaagcttcggaaatccgaaagaggcagtttaaggagctccta
gcagtcttttctgggttgctgatgctttctttgttggtggtcattattagtagtggcaac
aattctgattcccatgcaaataaaaatgagccagtgttttcggctaaagagccttataca
acaaggcccgccaaactgcgcccggtttctcggggcatagcagccggagtgtccgagaag
tcgaatcggttggccgatgctgtggacgggccggcctttccatggaacaatagcatgctg
tcatggcagagaactgctttccatttccagcctgagaagaactggatgaatgatccaaat
ggtccattattctacaaaggttggtaccactttttctaccagtggaatcccaacggtgca
gtatggggagacattgtatggggccatgcagtgtccaaggacttgatccattggcttcac
ctccctctagccatggtggctgaccagtggtacgacatcaatggagtctggactggctca
gccaccattctccctgatggcaaaattgtcatgctctacactggctcaaccaatgagtcg
gtccaagtccaaaaccttgcatatcctgctgaccacaatgaccctctcctcaccaaatgg
gtcaagtactccggcaacccgattctagtcccgcccccgggcgtcggatacaaggacttc
cgtgacccgacaactgcttggtacacgtcccaaggcaaatggcgcattactattgggtcc
aagcttaacaaaacaggcatatccttggtttatgataccaaggacttcaaaacctatgag
caattgaatggggtgcttcatgctgtccctgggactggaatgtgggagtgtgtggatttt
tatccggtgtcgaaaaccagtgacaaaggactggatacttcggtgaatgggcctgatgtg
aagcatgtggtgaaggctagtcttgatgatgataggaatgattactattcattggggtcc
tatgaggaaaagactggcaaatgggttcctgataaccaaaagattgatgttggaattgga
attaggtatgattatggcattttctatgcctccaagactttctatgaccaaaacaaggag
aggagagttttgtggggttggattggagagtctgatagtgaaaatgctgatatgcagaag
ggatgggcctccgttcagggaattccaaggacagtggtgtttgataagaagactggaagc
aatctacttcaatggccagtggaggaggtcgagaaattgagattgagcattacggacttc
gacaaggttgaggtcaaggcaggctcagtgctgccacttcaagttgtcacagccacacag
ttggacattgttgctgagttcgagttggacaagaaggttttggagagcgtagctgaatct
aatgaggtgttcagttgcaacaccagcgctggaggttcccatcgtggtgctttaggaccc
tttggtcttcttgttcttgcagatgagaccctctcagagcagactcctgtctacttttat
gtagccaaagggcctggtggcaattttgatactttcttttgcgccgatcaaacaaggtct
tctgtggctaatgacgttaagaaaaaagttactggcagctatgttccagttctaaaagat
gaaaaattatcggtgaggattctggttgaccattcgatcgtcgaaagctttgctcaaggt
ggaagaacaaccatcacaactagggtttacccaaccaaggcaatttatggggctgctagg
ctatttttgttcaacaatgctaccgataccagtgttactgcctccctcaaagtatggcag
atgaactctgcatttatccgtccgtaccatccggacgaaacgagcaacgcaagctcaaac
cttgttacctacctcaaattcattgtcacattctttatttttttaacttttatcttttct
tag

DBGET integrated database retrieval system