KEGG   Pyrus x bretschneideri (Chinese white pear): 103961660Help
Entry
103961660         CDS       T03446                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103961660
   00500 Starch and sucrose metabolism
    103961660
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103961660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 582 aa AA seqDB search
MMDITAIKLLVEVIFLACCYVFAINNITGVEALHNVYPEFQSLAAVKVKQVHRTAFHFQP
PRNWINDPNGPMYFGGLYHLFYQYNPEGAVWGNIVWAHSVSKDLINWEALEPAIHPSKPF
DVNGCWSGSATVLPGNKPIILYTGIDSQNRQVQNYAIPENASDPYLRKWIKPDNNPLVIP
DLGINATAFRDPTTAWWGNGHWKMLVGGKRKHRGMAYLYRSKDFVHWVKAHHPLHSAPQT
GMWECPDFYPVPLVGKLGLDTSKVGRDVKHVLKVSLDETRYEYYTVGTYFPEKDRYVPDK
ELVDGWSGLRYDYGNFYASKTFFDPAKKRRILWGWANESDTASNDAAKGWAGIQTIPRDV
WLSPDGKQLLKWPVVELETLRGKKVGINKQILKQGDHVEVKGITAAQADVEVIFTLPSLA
KAEEFNPSWSNLDAQTLCGKKGSKIQGGIGPFGLLTLASKNLEEFTPVFFRVFKAKGRHV
VLMCSDATSSSLQDNLYRPSFAGFVDVDLSHSKKLSLRSLIDHSVVESYGAGGKTCITSR
VYPTLAVNNGAHLYVFNNGTQPVTAESLNAWSMNAPTMNKRI
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgatggatattacagcaataaagttgcttgttgaagttatttttctcgcttgttgttat
gtttttgctataaacaacattaccggagtcgaagcgttgcacaatgtttatcccgagttt
cagtctcttgccgccgttaaggtgaagcaagtccacagaactgcgtttcactttcaacct
cccagaaactggattaatgaccccaatggacctatgtattttggtggtctctaccacttg
ttctatcagtacaatcctgaaggggctgtgtggggcaacattgtttgggcccattcagtg
tccaaagacctcatcaattgggaagccctggagccagccatacacccatccaagcccttt
gacgtaaatgggtgttggtccggatccgccactgttctcccgggtaacaagcccattata
ctatacaccggaatcgactcccaaaaccggcaagttcaaaactatgctatcccggaaaat
gcgtcggacccctatctccgtaaatggattaagcccgataacaacccgctcgtgattccg
gacttaggtattaacgccactgcgttccgagacccgacaacggcttggtggggtaatgga
cattggaagatgttggtgggaggcaaaaggaagcatagaggaatggcctatttgtatagg
agcaaggattttgtgcattgggtgaaggcccatcatcctctccactctgctccccaaacg
ggtatgtgggagtgccccgatttttacccggttccattggttggaaaattagggttggac
acatcaaaagttggtcgagatgtgaaacatgtgctgaaagtgagccttgatgagactagg
tatgagtactacacagttggaacatattttcctgagaaggataggtatgttcctgacaaa
gaattggtggatggttggagtggattgagatatgactatggtaacttttatgcatccaaa
actttctttgatcctgcaaagaagaggagaattttgtggggttgggctaatgaatctgat
acagctagcaatgatgctgctaagggatgggccggaattcagacaattccaagggatgtg
tggcttagtcctgatggtaaacaattgctaaaatggcctgttgtagaattagaaacatta
cgagggaaaaaggtgggcatcaacaagcaaattctcaagcagggagatcatgttgaagtc
aaaggaataactgctgctcaggctgatgttgaagtgatttttacacttccgagtttggcc
aaggctgaagaatttaaccctagctggagtaaccttgatgcccaaacactctgtggtaaa
aagggttcaaaaatccaaggtggaattggtccttttggactcttgacattagcttcaaaa
aacctagaagaattcactcctgtcttctttagggttttcaaagctaaaggcagacacgtg
gttctcatgtgctctgatgcaacaagttcatctttgcaggacaacctgtacagaccatca
tttgctggctttgtagatgtagatttatctcactctaagaagctttccctcaggagtttg
attgatcattctgttgttgaaagttacggagctggagggaaaacatgcatcacatctagg
gtttacccgactctagcggtaaacaacggtgctcacttgtatgtgttcaacaatgggact
cagcctgttactgcggagagtctcaatgcatggagtatgaatgctcccacgatgaacaag
cggatttag

DBGET integrated database retrieval system