KEGG   Plutella xylostella (diamondback moth): 105387151Help
Entry
105387151         CDS       T03915                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105387151
Peptidases [BR:pxy01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105387151
Exosome [BR:pxy04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105387151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 376 aa AA seqDB search
MGRIHGAFITVPLYTLVILLLGAYMAAAVLAVHVVVVPLVFKYSKIFQRSLIFGNFVQWP
LRIDHEDPSSSGIDGARNLRVEFQSKIDHCAIKLGVWHILPQTVHDRLSEAFERTDKEEL
HRMLDDELVNSKTPIVLYCHGNSNSRGAAHRIKMYKFLKKMEFHIIAFDYRGYGDSTNVY
PSELGVVEDALMVYEWLLNALSRGRVPPPVYVWGHSLGTGITSHLLGNLDVLSRRLLGRP
PLPLPQALGLEAPFNNLADEVKHHPAARVSLVNWLPYFDLTFVAPFRVAPQHTFRSDEYL
SRVKTLPVLILHARDDTIVPFEVGVQLYDDVLKSRSSGGAPVVMHAFDESQSLGHKYICD
ADNLEEVFRNFTALIH
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaatacacggtgcatttatcacagttcctctgtacactttggttatcctcctg
ctcggcgcgtacatggcagcagccgtgctggcggtgcacgtggtggtggtgccgctcgtc
ttcaagtactccaagatattccagcggagcctcatctttggcaactttgtgcaatggcca
ctacgcatagaccacgaggacccgtcgtcgagcggcatcgacggcgctcgcaacttgaga
gtcgagttccagtcaaagatcgaccactgcgccatcaaattgggtgtatggcacatccta
ccacaaacagtccacgacagactgagtgaggccttcgagagaacggacaaagaagaactg
catcgaatgttggacgacgaactagtgaactcaaagacgccgatagtgctgtattgtcat
ggaaactcaaactcgcgaggcgccgcacacagaatcaaaatgtacaagtttttgaagaag
atggaattccacatcattgctttcgactacagagggtacggagactccacaaacgtatat
ccgagtgagctcggagtggtggaagacgctctgatggtgtacgagtggcttctgaacgcg
ttgtcccgcggtcgagtcccgccgcccgtctatgtgtggggacattcattaggtacagga
ataacctcgcatctcctaggcaacctagacgtgctatctcgccggctgctgggccggccg
ccgctgccgctgccccaggcgctggggctggaggccccgttcaacaacctcgccgatgag
gtgaagcaccatccggctgctagggtttctctagtaaactggctcccctacttcgaccta
acattcgtggctccgttccgcgtggcgccgcaacacacgttccgttcagacgagtacctg
agccgagtgaagaccctaccggtgctcatactgcatgctagagatgatactattgtgcct
tttgaagttggagttcagctctacgacgacgtgctcaagtctcgctcgagcggcggcgcg
cccgtcgtgatgcacgcgtttgatgagtcgcagagcctcggacacaagtatatatgtgat
gccgacaacttggaggaggtttttaggaatttcactgctttgattcactga

DBGET integrated database retrieval system