KEGG   Pyrococcus yayanosii: PYCH_00240Help
Entry
PYCH_00240        CDS       T01543                                 

Definition
thermophile-specific fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pya  Pyrococcus yayanosii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PYCH_00240
   01230 Biosynthesis of amino acids
    PYCH_00240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_00240
   00030 Pentose phosphate pathway
    PYCH_00240
   00051 Fructose and mannose metabolism
    PYCH_00240
  Energy metabolism
   00680 Methane metabolism
    PYCH_00240
Enzymes [BR:pya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PYCH_00240
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PYCH_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21632..22756
Genome map
AA seq 374 aa AA seqDB search
MAVGEKITISVIKADVGGWPGHSRVHPALIERAKEVLAEAQKEGTIIDFYVTYVGDDLQL
IMTHKKGVDSPDVHGLAWEAFKKATEVAKALGLYGAGQDLLKDAFSGNVRGLGPSVAEME
ITLRKSEPIVTFHLDKTEPGAFNLPIFRMFADPFTTAGLVIDPKMHMGFRFEIWDILEHK
RVIMSSPEEMYDILALIGAKSRYVIKRVFPKEGHPIPKDEPVAVVSTEKLYEVAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVPLKYATPTRFDGPPRA
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITEYMRRHGPFEPHRLPLEEMEYTTL
PGVLEKLKDRFEPV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgggagagaagataaccataagcgtaataaaggctgatgttgggggttggcca
ggccactcgagggttcatccggccctgatagagagagcgaaggaagttcttgcagaggcc
cagaaagagggcacgataatagacttctatgtcacctacgtgggcgatgatctccagctc
atcatgacccacaagaagggtgttgacagccctgatgtccatggactcgcttgggaggct
ttcaagaaggctaccgaggtagctaaggcccttggtctttatggggctgggcaggatctc
cttaaggatgctttcagcgggaacgtgagaggccttggtccaagcgtcgctgagatggag
ataacccttaggaagagcgagcccatagtgacgttccaccttgacaagaccgaacctgga
gccttcaacctgccgatattcaggatgttcgccgaccccttcaccacggccggtctcgtc
attgaccctaagatgcacatgggcttccgcttcgagatatgggacatcctcgagcacaag
cgcgtcataatgagctctcccgaggaaatgtacgacatcctcgccctcataggagccaag
agtcgctacgtcatcaagcgtgtcttcccgaaggagggtcacccgatacctaaggacgag
cccgtcgccgttgtctcaacggagaagctctatgaagtggcgggagagtatgtgggtaag
gacgaccccgtcgcaatcgttagggctcagagcggtctcccggctcttggagaggtgttg
gagcccttcgcgttcccgcacctcgtcagtggctggatgcgcggttctcacaacggtccg
ctcatgcctgtcccgctcaaatacgcgactccgactaggttcgacggtccgcctagggcg
gttgctctgggttggcagataagccctgagggtaagctcgtcggtccggttgacctcttc
gacgacccagcctttgactacgctcgccagaaggcccttgagattaccgagtacatgagg
agacacggacccttcgagcctcacaggctcccgctcgaggagatggagtacacaaccctg
ccgggtgtcctcgagaagctcaaggaccgcttcgagcccgtctga

DBGET integrated database retrieval system