KEGG   Pyrococcus yayanosii: PYCH_00470Help
Entry
PYCH_00470        CDS       T01543                                 

Definition
Magnesium chelatase subunit ChlI family
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pya  Pyrococcus yayanosii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PYCH_00470
Enzymes [BR:pya01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PYCH_00470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42705..44618)
Genome map
AA seq 637 aa AA seqDB search
MEPREKRLVFPFSAIVGQEKAKLALLCVAVNPLIGGVLLKGDKGTGKSTLVRALANVLPE
IEVVDGCPFNCNPRNPLEMCDSCYERYEKGEELPVTKRKMRVVDLPLSVTIDRLVGTVDV
ERFLKEGKKALQPGILAEANRNVLYIDEVNLLDDYIADSLLDAAAMGWNTIEREGISFRH
PARFILVGSMNPEEGELRPQILDRFGLCVEVSAPMNPEERIEIVRRVEEFHEDPISFYKK
FESEEKKLTERIVKAREILPKVEISDDLLKLLAETVINLGIKTNRAEIATIKTAKAIAAL
NGRRRVSLEDLEKAMELALPHRLRDKPFQKPPQMRPPKPKEDKEHDHDHEHNHKHEHKKE
EKSESTRSQGIGNLEQNFRSSEAKIPRIESKNFDGDEFTSNRSSRDVSITVINYPRGIPI
SYLPPINGELKDVDFYNSLIWAVLNGKKPPIKLDLNDIRVRIRKAKAPTLWVLLLDSSGS
MAVQKRISIAKGIAEKLVENGYTKRSKMALIVAKGNQAEIFVPPTKNYWEVLEKIESVPT
GGRTPLSSALYNLLLLAERERRKDKSLKVRAFLITDGKANVSLFGKRIKDEITELARALK
RKEIELNVYDTRGRGIHPGISYVQILEKVANAKVYRI
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcgtgaaaaacgcttagtatttccattctccgcaatagtcgggcaggaaaag
gctaaattagccctactctgtgtagccgttaatcccctaatcggtggtgtcctgcttaaa
ggagataaggggacaggaaaatcaaccttggttagggctttagccaacgttttgccagaa
attgaagtcgttgatggctgtcccttcaactgcaatccaaggaatcccctagagatgtgc
gactcctgctacgagcgctatgagaaaggcgaggaactaccagtgacaaagaggaagatg
cgcgttgttgatttgcctcttagcgttacaatagatagactcgttgggaccgttgatgtt
gagagatttttgaaggagggcaaaaaagccctacaaccaggaattttagcagaggcgaac
agaaacgtgctctacatagacgaggtgaacctgctcgatgattacatagccgactcactt
ttagatgccgcggcaatggggtggaacacgatagagagggaaggaatctctttcaggcac
cccgcccgcttcatcctggtgggaagcatgaaccccgaggagggcgagctgaggccacag
atactcgacagattcggcttatgcgttgaagtttcagcaccaatgaacccggaggagagg
atagagatagttaggagagttgaagagttccatgaagacccgataagcttctataagaag
tttgagagcgaagagaagaagctcacggagaggatcgttaaggcaagggagattctgccg
aaggtcgagataagcgacgatctgctgaaacttttagccgaaactgtaattaatttggga
atcaaaaccaacagggctgagatagccacgataaagacggctaaagcaatagccgcccta
aacggaaggagaagggtctcactggaagacttggagaaggctatggaattagctttaccg
caccgcttgagggacaagcccttccaaaagccaccgcagatgaggcccccaaagcctaaa
gaggataaggagcacgatcacgaccacgaacataaccataagcatgagcacaagaaggaa
gaaaaaagtgaaagcactcgaagtcaggggattggaaatttagaacagaattttcgctca
agcgaagctaaaatcccaaggatagagagcaaaaactttgatggagacgaattcaccagc
aaccgttcctcaagggacgtcagcatcacggtgataaactaccccagaggcattccgatt
tcataccttccacctatcaacggcgaacttaaagacgttgatttctacaactccttgatt
tgggcagtgttgaacggcaaaaagccgccgataaaactcgatctaaacgacatccgcgtc
aggatcaggaaagcaaaggcaccaacgctctgggtcctgctcctggattcgagcggaagc
atggcagtgcagaagagaatcagcatagcaaagggaatagcggaaaagctggttgagaac
ggatatacaaagcggtcaaagatggccttgatagttgcgaaaggtaatcaggcggaaata
ttcgttccacctacgaagaactactgggaagtgcttgagaaaatagagagcgttccaact
ggagggagaacgcctttaagctctgccctctataatcttcttctgcttgctgaacgtgag
aggagaaaagacaagtccctgaaagtcagggcgttcttgataaccgacggaaaggccaac
gtgtcgctctttgggaagcgaattaaagatgaaataacggagctggcaagggccctgaag
aggaaagaaatagagcttaacgtctacgacacaagaggaagagggatacatccaggtatt
tcgtatgtccaaattttagaaaaagtcgcaaacgctaaagtctataggatatga

DBGET integrated database retrieval system