KEGG   Pyrococcus yayanosii: PYCH_00470Help
Entry
PYCH_00470        CDS       T01543                                 

Definition
(GenBank) Magnesium chelatase, subunit ChlI family
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00860  Porphyrin and chlorophyll metabolism
pya01100  Metabolic pathways
pya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PYCH_00470
Enzymes [BR:pya01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PYCH_00470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 MCM VWA AAA AAA_29 AAA_16 AAA_22 DUF815 TIP49 PAT1 TsaE Mg_chelatase_C NACHT
Motif
Other DBs
NCBI-ProteinID: AEH23760
UniProt: F8AFF3
Position
complement(42705..44618)
Genome map
AA seq 637 aa AA seqDB search
MEPREKRLVFPFSAIVGQEKAKLALLCVAVNPLIGGVLLKGDKGTGKSTLVRALANVLPE
IEVVDGCPFNCNPRNPLEMCDSCYERYEKGEELPVTKRKMRVVDLPLSVTIDRLVGTVDV
ERFLKEGKKALQPGILAEANRNVLYIDEVNLLDDYIADSLLDAAAMGWNTIEREGISFRH
PARFILVGSMNPEEGELRPQILDRFGLCVEVSAPMNPEERIEIVRRVEEFHEDPISFYKK
FESEEKKLTERIVKAREILPKVEISDDLLKLLAETVINLGIKTNRAEIATIKTAKAIAAL
NGRRRVSLEDLEKAMELALPHRLRDKPFQKPPQMRPPKPKEDKEHDHDHEHNHKHEHKKE
EKSESTRSQGIGNLEQNFRSSEAKIPRIESKNFDGDEFTSNRSSRDVSITVINYPRGIPI
SYLPPINGELKDVDFYNSLIWAVLNGKKPPIKLDLNDIRVRIRKAKAPTLWVLLLDSSGS
MAVQKRISIAKGIAEKLVENGYTKRSKMALIVAKGNQAEIFVPPTKNYWEVLEKIESVPT
GGRTPLSSALYNLLLLAERERRKDKSLKVRAFLITDGKANVSLFGKRIKDEITELARALK
RKEIELNVYDTRGRGIHPGISYVQILEKVANAKVYRI
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcgtgaaaaacgcttagtatttccattctccgcaatagtcgggcaggaaaag
gctaaattagccctactctgtgtagccgttaatcccctaatcggtggtgtcctgcttaaa
ggagataaggggacaggaaaatcaaccttggttagggctttagccaacgttttgccagaa
attgaagtcgttgatggctgtcccttcaactgcaatccaaggaatcccctagagatgtgc
gactcctgctacgagcgctatgagaaaggcgaggaactaccagtgacaaagaggaagatg
cgcgttgttgatttgcctcttagcgttacaatagatagactcgttgggaccgttgatgtt
gagagatttttgaaggagggcaaaaaagccctacaaccaggaattttagcagaggcgaac
agaaacgtgctctacatagacgaggtgaacctgctcgatgattacatagccgactcactt
ttagatgccgcggcaatggggtggaacacgatagagagggaaggaatctctttcaggcac
cccgcccgcttcatcctggtgggaagcatgaaccccgaggagggcgagctgaggccacag
atactcgacagattcggcttatgcgttgaagtttcagcaccaatgaacccggaggagagg
atagagatagttaggagagttgaagagttccatgaagacccgataagcttctataagaag
tttgagagcgaagagaagaagctcacggagaggatcgttaaggcaagggagattctgccg
aaggtcgagataagcgacgatctgctgaaacttttagccgaaactgtaattaatttggga
atcaaaaccaacagggctgagatagccacgataaagacggctaaagcaatagccgcccta
aacggaaggagaagggtctcactggaagacttggagaaggctatggaattagctttaccg
caccgcttgagggacaagcccttccaaaagccaccgcagatgaggcccccaaagcctaaa
gaggataaggagcacgatcacgaccacgaacataaccataagcatgagcacaagaaggaa
gaaaaaagtgaaagcactcgaagtcaggggattggaaatttagaacagaattttcgctca
agcgaagctaaaatcccaaggatagagagcaaaaactttgatggagacgaattcaccagc
aaccgttcctcaagggacgtcagcatcacggtgataaactaccccagaggcattccgatt
tcataccttccacctatcaacggcgaacttaaagacgttgatttctacaactccttgatt
tgggcagtgttgaacggcaaaaagccgccgataaaactcgatctaaacgacatccgcgtc
aggatcaggaaagcaaaggcaccaacgctctgggtcctgctcctggattcgagcggaagc
atggcagtgcagaagagaatcagcatagcaaagggaatagcggaaaagctggttgagaac
ggatatacaaagcggtcaaagatggccttgatagttgcgaaaggtaatcaggcggaaata
ttcgttccacctacgaagaactactgggaagtgcttgagaaaatagagagcgttccaact
ggagggagaacgcctttaagctctgccctctataatcttcttctgcttgctgaacgtgag
aggagaaaagacaagtccctgaaagtcagggcgttcttgataaccgacggaaaggccaac
gtgtcgctctttgggaagcgaattaaagatgaaataacggagctggcaagggccctgaag
aggaaagaaatagagcttaacgtctacgacacaagaggaagagggatacatccaggtatt
tcgtatgtccaaattttagaaaaagtcgcaaacgctaaagtctataggatatga

DBGET integrated database retrieval system