KEGG   Pyrococcus yayanosii: PYCH_00860Help
Entry
PYCH_00860        CDS       T01543                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00010  Glycolysis / Gluconeogenesis
pya01100  Metabolic pathways
pya01110  Biosynthesis of secondary metabolites
pya01120  Microbial metabolism in diverse environments
pya01130  Biosynthesis of antibiotics
pya01200  Carbon metabolism
pya01230  Biosynthesis of amino acids
Module
pya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pya_M00002  Glycolysis, core module involving three-carbon compounds
pya_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_00860
Enzymes [BR:pya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     PYCH_00860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEH23799
UniProt: F8AIH5
Position
complement(83068..84072)
Genome map
AA seq 334 aa AA seqDB search
MKVKVGINGYGTIGKRVAYAVTRQDDMELIGVTKTKPDFEAYRAEELGIPVYAASEEFLP
RFEKAGFEVAGTLNDLLEKVDVIIDATPGGMGAKNKPIYEKAGVKAIFQGGEKADVAQVS
FVAQANYEKALGKDYVRVVSCNTTGLVRTLSAIQDYIDYVYAVMIRRAADPNDIKRGPIN
AIKPSVTVPSHHGPDVQTVIPINIETSAFVVPTTIMHVHSVMVELKKPLEAKDVIEIFEN
TTRVILFEKEKGFESTAQLIEFARDLHREWNNLYEIAVWKESISVRGNRLFYIQAVHQES
DVVPENIDAIRAMFEMADKWESIKKTNESLGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaaggttgggataaacggctacggaacgataggaaagcgcgtcgcttacgcc
gtcacaaggcaggatgatatggagctcatcggagtaaccaagacgaagcccgatttcgag
gcctacagggcagaggagctcggcatcccggtctatgcggcgagcgaggagttcctcccg
cgctttgaaaaggctggcttcgaggtagcaggaacgctgaacgacctcctagagaaggta
gacgtcataatcgatgccactcccggcggaatgggggccaagaacaagcccatctacgaa
aaggctggcgtcaaagcgattttccagggcggtgagaaggcggacgtcgcccaggtctcc
ttcgttgcccaggccaactacgagaaggctctcggcaaggactatgtccgcgtggtttcg
tgcaacacgacgggtctcgttagaaccctcagtgctatacaagactacatagattacgtt
tatgccgtgatgattcgccgtgcagcagacccgaacgacataaagagggggccgataaac
gccataaagccaagcgttaccgtgccatcgcaccatgggccagatgtccaaacggttatc
ccgataaacattgaaacgagtgccttcgtcgtgccgaccacgataatgcatgtacacagc
gtcatggtcgagctcaagaagccccttgaggccaaggatgtaattgagattttcgagaac
actacaagggttatcctcttcgagaaggagaagggcttcgagagcacggcccagctcata
gagttcgcccgcgacctgcacagggagtggaacaacctctacgagatagccgtctggaag
gagagcataagcgtgagaggaaacagactcttttacatccaggctgtccaccaggagagt
gatgtagtgcctgagaacatcgatgcgataagggccatgttcgagatggcggataaatgg
gagagcataaaaaagacgaacgagagccttggaattttgaagtga

DBGET integrated database retrieval system