KEGG   Pyrococcus yayanosii: PYCH_00960Help
Entry
PYCH_00960        CDS       T01543                                 

Definition
(GenBank) aminopeptidase
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
pya  Pyrococcus yayanosii
Brite
Enzymes [BR:pya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     PYCH_00960
Peptidases [BR:pya01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   PYCH_00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
91274..92311
Genome map
AA seq 345 aa AA seqDB search
MVDWALMQRVIEAPGVSGYEHLGIRDLVVDILKEVADEVKVDKLGNVIARFKGSSPKVMV
SAHMDKIGVMVNHIDKDGYLHIVPVGGVLPQTLVAQRIRFFTEKGERYGVVGVVPPHLRK
PEERNKSVDWDAIVVDIGAGSKEEAEEMGFRIGTVGEFAPAFTRLSEHRFATPYLDDRIC
LYAMIETARSLGEHEADIYFVASVQEEVGLRGARVASYAINPEIGIAMDVTFAKQPGDKG
KIVPELGKGPVMDVGPNINPKLRAFADEVAKKHDIPLQVEPSPRPTGTDANVMQINREGV
AIAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELRPMDLTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtggactgggcccttatgcaacgggttatagaggctcctggagtttcaggctacgag
cacctcggcataagggacctggtggttgacatcctcaaggaggttgcggacgaggtcaag
gtggacaagctaggtaacgtaatcgcaaggttcaagggatcttctccaaaggtcatggtt
tccgcgcatatggacaagataggcgtcatggtgaaccacatagacaaagacggctacctc
cacatcgtcccggtaggcggcgtcctccctcagacgctagtcgcccagcgcatacgcttc
ttcacagaaaagggagagcgctacggagtcgttggtgttgtgccacctcacctcagaaag
cccgaggagaggaacaagtctgttgactgggacgcgatagtggtggatattggcgctggg
agcaaggaagaggctgaagagatgggcttccgcattggaaccgttggtgagtttgccccc
gctttcacacggctgagcgagcaccgctttgctacgccctatctcgacgaccgcatctgc
ctctacgccatgattgagaccgctaggagcctcggggagcacgaggctgacatatatttt
gtggcgagcgttcaggaggaggttgggctgaggggagcccgcgtggcctcctatgctatc
aacccggagataggcatagctatggacgtcaccttcgcgaagcagccgggcgataagggg
aagatagtaccggagctgggtaagggacccgtcatggacgtgggcccgaacataaacccg
aagcttagggccttcgctgatgaagttgccaagaagcacgacatacctcttcaggtggag
cctagcccaaggcccaccggcacggatgccaacgtcatgcagataaacagggagggtgtt
gccatcgccgtgctcagcatacccatccgctacatgcactcccaggtcgagctggccgac
gcgagggacgtcgataacacgataaagctcgcgaaggctctcctcgaggagctcaggccc
atggacctgacgccgtga

DBGET integrated database retrieval system