KEGG   Pyrococcus yayanosii: PYCH_03000Help
Entry
PYCH_03000        CDS       T01543                                 

Definition
hypothetical protein
Orthology
K09722  
4-phosphopantoate---beta-alanine ligase [EC:6.3.2.36]
Organism
pya  Pyrococcus yayanosii
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:pya00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(245319..246104)
Genome map
AA seq 261 aa AA seqDB search
MVRIPKSHPRYWSLLYREKIIESMEEGITAKAGLIAHGRGEAFDYLIGERTIEPAERAMK
VAVAKLLLAEYPVISVNGNVAALVPRETVELAKAVNAKLEVNLFYRTEERVRKIAALLKE
HGAGEVLGLNPTKKIPGLESERGKVDENGIWKADVVLVPLEDGDRTEALVRMGKFVITVD
LNPLSRSARMAHVTIVDNIVRAYPRMIELAREMRDYDRKELEKIVKEYDNERTLSDVLRH
IRDRLTRLAEEGIWRRERLVT
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtaaggatacctaagagccatccccgatactggagcctgctctacagggaaaaaata
atcgagagcatggaggagggaataactgcaaaggccggtctcatagcccatggacgcggt
gaggctttcgattacctcatcggcgagagaaccatcgaaccggcagagagggcgatgaaa
gttgcggtagccaagctcctcctcgcggagtatcccgttatctctgttaatggcaacgtg
gctgccttagtcccccgggaaaccgtcgagcttgccaaggccgtgaacgcaaagctggag
gtaaacctcttctacaggacggaggagagggttaggaagatagcggcactccttaaggag
cacggggcgggggaggtgcttggcctgaacccaacaaagaagatccccggtctcgagagc
gagcgtggaaaggtggatgaaaacggaatctggaaggccgacgtggtcctcgtcccgctc
gaggacggcgacaggacggaagccctcgtaagaatgggcaagttcgtgataaccgtcgat
ttaaaccctctctcgcgctccgcgaggatggctcacgtaacaatagtggacaatatcgtg
agagcatatccacggatgattgagctggcgagggagatgagagactatgacaggaaggag
cttgagaaaatcgtgaaggagtacgacaacgaaagaacgctgagcgatgtccttaggcac
ataagggacagactcacccgccttgcggaggaaggaatctggaggcgggagaggctggtt
acctaa

DBGET integrated database retrieval system