KEGG   Pyrococcus yayanosii: PYCH_03000Help
Entry
PYCH_03000        CDS       T01543                                 

Definition
hypothetical protein
Orthology
K09722  
4-phosphopantoate---beta-alanine ligase [EC:6.3.2.36]
Organism
pya  Pyrococcus yayanosii
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PYCH_03000
Enzymes [BR:pya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.36  4-phosphopantoate---beta-alanine ligase
     PYCH_03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(245319..246104)
Genome map
AA seq 261 aa AA seqDB search
MVRIPKSHPRYWSLLYREKIIESMEEGITAKAGLIAHGRGEAFDYLIGERTIEPAERAMK
VAVAKLLLAEYPVISVNGNVAALVPRETVELAKAVNAKLEVNLFYRTEERVRKIAALLKE
HGAGEVLGLNPTKKIPGLESERGKVDENGIWKADVVLVPLEDGDRTEALVRMGKFVITVD
LNPLSRSARMAHVTIVDNIVRAYPRMIELAREMRDYDRKELEKIVKEYDNERTLSDVLRH
IRDRLTRLAEEGIWRRERLVT
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtaaggatacctaagagccatccccgatactggagcctgctctacagggaaaaaata
atcgagagcatggaggagggaataactgcaaaggccggtctcatagcccatggacgcggt
gaggctttcgattacctcatcggcgagagaaccatcgaaccggcagagagggcgatgaaa
gttgcggtagccaagctcctcctcgcggagtatcccgttatctctgttaatggcaacgtg
gctgccttagtcccccgggaaaccgtcgagcttgccaaggccgtgaacgcaaagctggag
gtaaacctcttctacaggacggaggagagggttaggaagatagcggcactccttaaggag
cacggggcgggggaggtgcttggcctgaacccaacaaagaagatccccggtctcgagagc
gagcgtggaaaggtggatgaaaacggaatctggaaggccgacgtggtcctcgtcccgctc
gaggacggcgacaggacggaagccctcgtaagaatgggcaagttcgtgataaccgtcgat
ttaaaccctctctcgcgctccgcgaggatggctcacgtaacaatagtggacaatatcgtg
agagcatatccacggatgattgagctggcgagggagatgagagactatgacaggaaggag
cttgagaaaatcgtgaaggagtacgacaacgaaagaacgctgagcgatgtccttaggcac
ataagggacagactcacccgccttgcggaggaaggaatctggaggcgggagaggctggtt
acctaa

DBGET integrated database retrieval system