KEGG   Pyrococcus yayanosii: PYCH_04600Help
Entry
PYCH_04600        CDS       T01543                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pya  Pyrococcus yayanosii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PYCH_04600
Enzymes [BR:pya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PYCH_04600
    3.5.1.-  
     PYCH_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378690..379235
Genome map
AA seq 181 aa AA seqDB search
MPEEALIVVDMQRDFMPGGALPVPDGDRIIPRVNEYIRRFREKGALIVATRDWHPDNHIS
FRELGGPWPRHCVQNTPGAEFVVELPADAVIISKATEPDKEAYSGFEGTNLAGILKEKGV
RRVYICGVATEYCVKATALDAVKHGFEVYLLKDAVKGIKPGDEEMAIREMEEAGVKILPS
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggaggcccttatagttgttgacatgcagagggatttcatgcccggcggtgct
ctgcccgttcctgacggcgacaggataatcccccgcgtgaacgagtacataaggcggttc
agggagaagggagcattgatagtcgccacgagggactggcaccccgataaccacatcagc
tttagggagcttggcggcccttggccgaggcactgtgttcaaaacactccaggggcagag
ttcgtggtggaacttccggccgatgcggtgataatatccaaagccacggagcctgacaag
gaggcctactccggtttcgagggaacgaacctcgccgggatactaaaggaaaagggcgtt
agacgcgtctacatatgcggcgttgccaccgagtattgtgtcaaggccacagccctcgat
gctgtgaagcacggcttcgaggtttacctactgaaggatgccgtcaagggcattaagcct
ggggacgaggagatggccataagggaaatggaagaagccggagtcaagatacttccttcc
ctttaa

DBGET integrated database retrieval system