KEGG   Pyrococcus yayanosii: PYCH_05360Help
Entry
PYCH_05360        CDS       T01543                                 

Definition
formaldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pya  Pyrococcus yayanosii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PYCH_05360
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PYCH_05360
Enzymes [BR:pya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PYCH_05360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444472..446331
Genome map
AA seq 619 aa AA seqDB search
MKGWWGRILRIDLTTGKVRVQEYSPNIAQQFIGGRGLAIKILWDEVKGVDPLSPENKLIF
AAGPFNGLPTPSGGKMVVAAKSPLTGGYGDGNLGTMATVHLRKAGYDALVVEGKAKKPVY
IYIEDDNVSILSAEGLWGRGTFETERKLREIHGKNVGILSIGPAGENLVRYAVVMSQEGR
AAGRPGMGAVMGSKNLKAVVIRGTKDIPVADKEELKRLSQEAYQAILNSPGYPFWKRQGT
MAAVEWTNENYALPTRNFQDGQFEFARSIDGYTLEGMKVKQRGCPYCNMPCGNVVLDVEG
LESELDYENVALLGSNLGIGKLNEVAALNRIADDMGMDTISLGVSIGFVMEAVERGLLKE
GPTFGDFKGAKQLALDIAYRRGELGNFAAEGVMRMAQKLGDDSFAMHVKGLEVSGYNSYI
YPAMALAYGTSSIGAHHKEAWVIAWEIGTAPIEGEQAKKVEYKITYSPEKPAKVIELQRL
RGGLFEMLTACRLPWVEVGLSLDYYPRLLEAITGVKYTWDDLYKAADRVYALIRAYWVRE
FNGKWDRTMDYPPKRWFIDGLKSGPYKGQHLDREKYDALLSEYYRLRGWDERGIPKKETL
KELGLEFVIPELEKVTELH
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttggtggggaagaattctcaggatcgatctgaccaccggcaaggtcagggtt
caggaatactcccccaacatcgcccagcagttcataggtggcaggggtcttgcaatcaag
attctctgggacgaggtcaagggcgttgatccgcttagtccggagaacaagctaatattc
gctgccggaccatttaacggcctgcctacaccaagcggtggcaagatggtagtcgcagcg
aagagcccgctcactggtggctacggtgacgggaaccttggaacaatggctaccgtccat
ctgaggaaggctggctacgatgccctcgtcgtcgagggcaaggcgaaaaagccggtctac
atatacattgaggatgataacgtgagcatactcagcgcagaaggcctctggggtagggga
accttcgagaccgagaggaagctcagggagatacacggcaagaacgttggaatactaagc
ataggtcccgcaggtgagaacttagttaggtacgccgtcgtcatgtcccaggagggcaga
gcggctggaaggcccggtatgggtgccgtaatgggaagcaagaatcttaaggctgtggtc
ataaggggaaccaaggatatacccgtcgccgataaagaggagctcaagaggctcagtcaa
gaggcttatcaggccatactcaactcgcccggctatccgttctggaagaggcagggcaca
atggccgcggtggaatggacgaatgagaactacgccttaccaacaaggaacttccaggac
ggtcagttcgagtttgcccgctccattgacggctacaccctcgaggggatgaaggtcaag
cagagaggttgcccctactgtaacatgccctgcggaaacgttgtccttgacgtcgagggt
ctagagagcgagctcgactatgagaacgtcgcccttcttggttcgaacctcggcataggg
aagctcaacgaggtcgccgccctcaacaggattgccgacgacatgggcatggacactatc
tcgcttggcgtctccataggcttcgtcatggaggccgtcgagaggggtctgcttaaggaa
gggccgacctttggcgacttcaagggcgccaaacaactggcccttgacatagcctatcgc
agaggagaactcggtaacttcgcggccgagggggtcatgaggatggcccagaagctcggc
gatgacagcttcgccatgcacgttaagggcctcgaggtcagtggatacaacagctacatt
tatcccgcgatggccctcgcctacggaaccagctccataggtgcccaccataaggaggcc
tgggtcatagcctgggagattggaacggccccaatcgagggtgagcaggccaagaaggtc
gagtataagataacctacagtccggagaagcccgccaaggtcatagagctccagaggctc
aggggcggtctcttcgagatgctcaccgcctgtagactgccatgggtcgaggttggcctg
agtctcgactactacccgaggctccttgaagccataaccggcgtcaagtacacctgggac
gacctatataaagctgcggacagggtctacgcccttatcagggcctactgggtcagggag
ttcaacggcaagtgggacagaacgatggactatccgcctaagaggtggttcattgatggt
ctcaagagcggaccctacaagggccagcacctcgacagggagaagtacgatgctctgctc
agcgagtactacaggcttaggggctgggacgagcgtggaataccgaagaaggagaccctc
aaggagctcggcctcgaattcgtcattccagagctggagaaggtcacggagctccactga

DBGET integrated database retrieval system