KEGG   Pyrococcus yayanosii: PYCH_05760Help
Entry
PYCH_05760        CDS       T01543                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00790  Folate biosynthesis
pya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PYCH_05760
Enzymes [BR:pya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PYCH_05760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD DUF561
Motif
Other DBs
NCBI-ProteinID: AEH24264
UniProt: F8AI37
Position
complement(478564..479382)
Genome map
AA seq 272 aa AA seqDB search
MKFAGVKLDEPRIMGVINVSPESFYKGSVRNNEKALVETAVKMVDEGASFIDIGAKSTAP
YLETQIPLEEEIRRAKWAIKIVKDVVDVPVSIDTTNAKVAEEALKAGADIINDVTGFKGD
PDMAKVASEYSAPVVLCAHGQVRDLLDPVKTVIEFLQESLAIAEEHGIKDIAIDPAIGFL
RPAYPPWYEWDSKVIANLNLLKLFGRPILIGVSRKSFIGAITRRKDPSERLAGSLSATAI
AVLKGANIVRTHDVRETLDAVKVADFVRRFIP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgcgggtgttaaactggacgagccgaggataatgggtgtcataaatgtctca
cccgaaagcttctacaaggggagtgtgagaaacaatgagaaggccttagttgaaacggca
gtgaagatggttgatgagggggcaagtttcatagatatcggagccaaatctactgccccc
tatctcgagactcagataccgctcgaggaggaaattagacgggccaagtgggcaattaaa
attgtcaaggatgttgttgatgtcccggtgagtatagatacaacgaacgctaaggtcgcc
gaggaagctctcaaggccggtgctgacataataaatgatgttacgggttttaaaggagac
cctgacatggcaaaagttgcctcagaatacagtgctccagtcgttttatgcgcccatggg
caggtgagagacttacttgaccctgttaaaacagtcattgagttcctacaggaaagtctg
gcaatagctgaggaacatgggattaaggatatagccattgaccccgcaataggattccta
agacctgcctatccaccctggtacgagtgggactcaaaggtcatagcaaatttaaacctc
ctcaaactgttcggaaggcccatccttatcggtgtctcgaggaaatcttttatcggagcc
ataacaaggagaaaagacccatccgagagattggcgggcagcctctctgcgacggcaata
gccgtcttgaagggggcgaacatagttagaacccacgacgtcagggagacgctcgatgcc
gttaaggtagctgattttgtgaggcgatttattccctaa

DBGET integrated database retrieval system