KEGG   Pyrococcus yayanosii: PYCH_06630Help
Entry
PYCH_06630        CDS       T01543                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
pya  Pyrococcus yayanosii
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PYCH_06630
Enzymes [BR:pya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     PYCH_06630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(560952..561887)
Genome map
AA seq 311 aa AA seqDB search
MEVPENVKKKVTIPFEEHFFAGHTACQGCGASLALRYVLKAYGKKTIIAIPACCSTIIAG
PWPYSTLNVPLFHTAFETTGAVISGIEAGLKALGYKVKGDDGIMVVGWAGDGGTADIGLQ
ALSGMLERGHDAVYIMYDNEAYMNTGIQRSSSTPYGAWTTNTPGGKRHFLEKKHKKKVID
IVIAHRIPYAATASIAYPEDLIRKLKKAQKIPGPSFIQLFAPCPTGWRAPTDKTIELARL
AVQTAYFPLFEYENGKYKINMPNPKKEPKPIEEFLKLQGRFKYMTKEDVEILQKWVLDEW
ERLKKLAEVFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaggttcccgagaacgttaagaaaaaggtcacgataccctttgaggagcacttcttc
gccggccacaccgcttgccagggttgtggtgcctcccttgctctccgctacgtgcttaag
gcctacggcaagaagacgataattgcgattcccgcctgctgttcgactataatcgctggc
ccctggccgtactctaccctcaatgtcccgctcttccataccgccttcgagaccactggt
gcagtgataagcggcattgaggccggcctcaaggctcttggctacaaggttaagggtgac
gatggcattatggtcgttggatgggccggcgacggtgggactgctgatataggactccaa
gctctctctggcatgcttgagaggggacatgatgcggtctacattatgtatgacaacgaa
gcttacatgaacacgggaattcagcgctcaagctccaccccctacggagcctggacaacc
aacacgccgggcgggaagaggcacttccttgagaagaagcacaagaagaaggtcatagac
atcgttatagctcaccgcataccttacgctgctacggcgagcatcgcctatccggaggat
ctaataaggaagctcaagaaggcccaaaagataccggggccaagtttcatccagctcttt
gctccatgcccaactggttggcgtgccccgaccgacaagacaattgagcttgcccgcttg
gccgtgcagacggcttacttcccgctcttcgagtacgagaatgggaagtacaaaataaac
atgccaaatcccaagaaggagcccaagccaatcgaggagttcctcaagctccagggcagg
ttcaagtacatgaccaaggaagacgtggaaattcttcagaagtgggtgcttgatgagtgg
gagaggctcaagaaacttgctgaagtgttcggctga

DBGET integrated database retrieval system