KEGG   Pyrococcus yayanosii: PYCH_06640Help
Entry
PYCH_06640        CDS       T01543                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit alpha
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
pya  Pyrococcus yayanosii
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pya00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(561893..563077)
Genome map
AA seq 394 aa AA seqDB search
MEYKPIKKVISGNYAAAYAALHARVQVVAAYPITPQTSIIEKIAEFIANGEADIQYIPVE
SEHSAMAACIGASATGARVFTATSAQGLALMHEMLHWASNARLPIVMVDVNRAMAPPWSV
WDDQTDSLSQRDTGWMQFYAENNQEVYDGVLMAFRVAETVNLPAMVIESAFILSHTYDIV
EMIPQELVDEFLPPRKPLYTLTDFDNPIAVGGLATPADYYEFRYKIAMAMEKAKEVIKEV
GREFGERFGRDYSQMIETAYIDDADFVFMGMGSLMGTVKEAVDILRREGYKVGYAKVRWF
RPFPREELIEIAERVKGIAVLDRNFSFGQEGILFNEAKGVLYNTGLRPIMKNYIVGLGGR
DFTVKDAKVIADDMRKLIERGKLDKEVEWYHLKR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggagtacaagccaattaagaaggtcataagtggtaactatgcggccgcttatgcggct
ctccacgctcgtgttcaggttgtcgccgcctatccaatcacaccgcaaacaagcattatc
gagaagatagccgagtttatagctaacggtgaggctgatattcagtatatccccgttgag
agcgagcactcggcgatggctgcttgtataggtgcctccgctacgggggctagggttttc
acggccacgtccgctcaaggtttagctttgatgcacgagatgcttcactgggctagcaat
gccaggctaccgatagtcatggtggacgttaacagggctatggctccgccttggagcgtt
tgggatgatcagaccgatagcttgtcgcagagggatactggctggatgcagttctatgct
gagaacaatcaggaggtttacgatggcgttttgatggcattcagggtcgccgagaccgtt
aacctgcctgccatggtcatcgagagtgctttcatcctgagccacacctacgatatcgtt
gaaatgattccccaggagctcgttgacgagttccttccgccgaggaagcctctctacacg
ctcaccgacttcgataaccccatcgccgtcggcggccttgcaacacctgccgactactac
gagtttaggtataaaatagcgatggccatggagaaagccaaggaggtcattaaggaagtt
ggaagggagtttggggaacgctttggtagggactatagtcagatgatagaaaccgcctac
atagacgatgcggacttcgtcttcatgggaatgggttcccttatggggaccgttaaggag
gctgtggacatcctgagaagggagggttacaaggtcggctacgccaaggttcgctggttc
aggcctttcccgagggaggagcttatcgagatagccgagagagtcaagggaatagccgtc
cttgacaggaacttctccttcggtcaggagggcatactctttaacgaagccaaaggtgtt
ctttacaacaccggccttaggccaataatgaagaattacatcgttggccttggaggaagg
gactttactgtgaaggacgcgaaggtcatagctgatgatatgaggaagctcatcgagagg
ggcaagctggataaggaagtggagtggtatcacctcaagaggtga

DBGET integrated database retrieval system