KEGG   Pyrococcus yayanosii: PYCH_06660Help
Entry
PYCH_06660        CDS       T01543                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00010  Glycolysis / Gluconeogenesis
pya00020  Citrate cycle (TCA cycle)
pya00620  Pyruvate metabolism
pya00640  Propanoate metabolism
pya00650  Butanoate metabolism
pya00680  Methane metabolism
pya00720  Carbon fixation pathways in prokaryotes
pya01100  Metabolic pathways
pya01120  Microbial metabolism in diverse environments
pya01130  Biosynthesis of antibiotics
pya01200  Carbon metabolism
Module
pya_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_06660
   00020 Citrate cycle (TCA cycle)
    PYCH_06660
   00620 Pyruvate metabolism
    PYCH_06660
   00640 Propanoate metabolism
    PYCH_06660
   00650 Butanoate metabolism
    PYCH_06660
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PYCH_06660
   00680 Methane metabolism
    PYCH_06660
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PYCH_06660
Enzymes [BR:pya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PYCH_06660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AEH24354
UniProt: F8AII8
Position
complement(563435..563992)
Genome map
AA seq 185 aa AA seqDB search
MIEIRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRI
KTQIYEPDVVVVLDPSLLDTVDVTAGLREGGIVIVNTEKSKDEVLEKLKKKPAKLALVDA
TTIALEILGLPITNTAILGAVAKATGLVKIESIEEAIKDTFSGELGEKNARAAREAYEKT
QVFEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatagagattcgttttcacggtaggggtggacaaggtgcagttacggccgcgaacatt
cttgccgaagcagcgttcttggagggcaaatatgtgcaggccttccccttcttcggtgtc
gagcgcaggggtgctccagttacggccttcacgaggatagacgagaagccaatccgcata
aagactcagatatatgagcctgatgttgtcgtcgttcttgatccgtctctccttgatacc
gttgacgttactgcaggccttagggagggcgggatagtcatagttaacacagagaagagc
aaggatgaggttctggagaagctcaagaagaagcccgccaagcttgccctcgtggatgcc
acgacaatagccctggagatacttggccttccgataaccaacaccgcaatcctcggtgcc
gttgcaaaggcgaccggtcttgtgaagatagagagcattgaggaagccataaaggacact
ttctctggcgaactcggtgagaagaacgcaagggcggctagggaagcttatgagaagacg
caggtctttgagctctga

DBGET integrated database retrieval system