KEGG   Pyrococcus yayanosii: PYCH_06990Help
Entry
PYCH_06990        CDS       T01543                                 

Definition
phosphohexomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pya  Pyrococcus yayanosii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_06990
   00030 Pentose phosphate pathway
    PYCH_06990
   00051 Fructose and mannose metabolism
    PYCH_06990
   00052 Galactose metabolism
    PYCH_06990
   00500 Starch and sucrose metabolism
    PYCH_06990
   00520 Amino sugar and nucleotide sugar metabolism
    PYCH_06990
  Nucleotide metabolism
   00230 Purine metabolism
    PYCH_06990
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PYCH_06990
Enzymes [BR:pya01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PYCH_06990
    5.4.2.8  phosphomannomutase
     PYCH_06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592763..594133
Genome map
AA seq 456 aa AA seqDB search
MGKLFGTFGVRGIANEDITPEFALKLGMAFGTMLKRENPAKELWVVVGRDTRVSGEMLKN
ALISGLLSVGVNVIDVGIAPTPAVQFACKHFRADGGAVITASHNPPEYNGIKLLEPNGMG
LKKEREAIVEEIFLKEDFDRAEWDEIGRVRREDIIRPYIDAIKSKVDVDAIRKRKPFVVV
DTSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPSEENLKGLMKIVKALGADFG
VAQDGDADRAVFIDENGRFIQGDKTFALVADAVLRERGGGLLVTTVATSNLLDDIAKRNG
AKVLRTKVGDLVVARALLEHAGTIGGEENGGVIFPDHVLGRDGAMTVAKVVEIFAKSGKK
FSELIDELPKYYQIKTKRHVEGDRKAVVAKVGELARRRGYRIDTTDGVKVIFEEGWVLVR
ASGTEPIIRIFSEAKSEEKAQEYLELGLELLEKAME
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagttattcgggacatttggcgttaggggaatagcgaatgaggatataactcca
gagttcgccctgaagctcggcatggccttcgggacgatgctgaagagggagaacccagcg
aaggagctttgggtcgtggttggcagagatacgcgcgtgagtggggagatgctcaagaac
gccttaataagcggcctcctgagtgttggagtcaatgttatcgacgttggaatagcacca
acgcctgcagttcaatttgcctgcaaacatttcagggccgatgggggagcagtaatcacc
gccagtcataaccctccggaatacaacggaataaagctcctcgagcccaacggcatgggc
cttaagaaggaaagggaagcgattgtagaggagattttcctcaaggaggactttgacagg
gcagagtgggatgagataggtagggttagacgggaggatatcataagaccgtacatcgac
gcgataaagagcaaggtcgacgtggatgcaataaggaagagaaagccatttgtagtcgtt
gacacctccaacggcgccggctcccttacgttgccatacctccttcgggagctcgggtgt
aaggttgtgagcgtcaacgcacatccggatggccacttcccggccagaaacccagaacct
agcgaggagaacctcaaaggattaatgaaaattgtcaaggcccttggagcggactttgga
gttgctcaggatggcgacgcagatagggccgtcttcatagatgaaaacgggcgcttcatc
caaggagacaagacgtttgccctcgttgctgatgccgtcctcagggaaagggggggtggc
ctgcttgtcactactgtggctacctctaacctgcttgatgatatagcgaagcgcaatggg
gctaaggttctcaggacgaaggtaggtgacctcgtggttgcaagggctctccttgagcac
gccggaacaataggcggcgaggagaacgggggcgtcatcttcccggaccacgttttggga
agggacggcgcgatgacggtagcgaaggtagtggagatattcgcgaagagcggcaagaag
ttcagtgagctcatcgatgagttgccaaagtattaccagataaagaccaagaggcacgtt
gagggcgacaggaaggcagttgttgcgaaagttggggaacttgcgaggagaaggggctac
aggatagacaccaccgatggcgttaaggtaatcttcgaggagggctgggttctcgtgaga
gccagcggaacggagccgataataaggattttcagcgaggccaagagtgaggagaaggcc
caagaatacctcgagctaggccttgagcttcttgagaaagcaatggagtaa

DBGET integrated database retrieval system