KEGG   Pyrococcus yayanosii: PYCH_06990Help
Entry
PYCH_06990        CDS       T01543                                 

Definition
(GenBank) phosphohexomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00010  Glycolysis / Gluconeogenesis
pya00030  Pentose phosphate pathway
pya00051  Fructose and mannose metabolism
pya00052  Galactose metabolism
pya00230  Purine metabolism
pya00500  Starch and sucrose metabolism
pya00520  Amino sugar and nucleotide sugar metabolism
pya00521  Streptomycin biosynthesis
pya01100  Metabolic pathways
pya01110  Biosynthesis of secondary metabolites
pya01120  Microbial metabolism in diverse environments
pya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_06990
   00030 Pentose phosphate pathway
    PYCH_06990
   00051 Fructose and mannose metabolism
    PYCH_06990
   00052 Galactose metabolism
    PYCH_06990
   00500 Starch and sucrose metabolism
    PYCH_06990
   00520 Amino sugar and nucleotide sugar metabolism
    PYCH_06990
  Nucleotide metabolism
   00230 Purine metabolism
    PYCH_06990
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PYCH_06990
Enzymes [BR:pya01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PYCH_06990
    5.4.2.8  phosphomannomutase
     PYCH_06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEH24387
UniProt: F8AIL9
Position
592763..594133
Genome map
AA seq 456 aa AA seqDB search
MGKLFGTFGVRGIANEDITPEFALKLGMAFGTMLKRENPAKELWVVVGRDTRVSGEMLKN
ALISGLLSVGVNVIDVGIAPTPAVQFACKHFRADGGAVITASHNPPEYNGIKLLEPNGMG
LKKEREAIVEEIFLKEDFDRAEWDEIGRVRREDIIRPYIDAIKSKVDVDAIRKRKPFVVV
DTSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPSEENLKGLMKIVKALGADFG
VAQDGDADRAVFIDENGRFIQGDKTFALVADAVLRERGGGLLVTTVATSNLLDDIAKRNG
AKVLRTKVGDLVVARALLEHAGTIGGEENGGVIFPDHVLGRDGAMTVAKVVEIFAKSGKK
FSELIDELPKYYQIKTKRHVEGDRKAVVAKVGELARRRGYRIDTTDGVKVIFEEGWVLVR
ASGTEPIIRIFSEAKSEEKAQEYLELGLELLEKAME
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagttattcgggacatttggcgttaggggaatagcgaatgaggatataactcca
gagttcgccctgaagctcggcatggccttcgggacgatgctgaagagggagaacccagcg
aaggagctttgggtcgtggttggcagagatacgcgcgtgagtggggagatgctcaagaac
gccttaataagcggcctcctgagtgttggagtcaatgttatcgacgttggaatagcacca
acgcctgcagttcaatttgcctgcaaacatttcagggccgatgggggagcagtaatcacc
gccagtcataaccctccggaatacaacggaataaagctcctcgagcccaacggcatgggc
cttaagaaggaaagggaagcgattgtagaggagattttcctcaaggaggactttgacagg
gcagagtgggatgagataggtagggttagacgggaggatatcataagaccgtacatcgac
gcgataaagagcaaggtcgacgtggatgcaataaggaagagaaagccatttgtagtcgtt
gacacctccaacggcgccggctcccttacgttgccatacctccttcgggagctcgggtgt
aaggttgtgagcgtcaacgcacatccggatggccacttcccggccagaaacccagaacct
agcgaggagaacctcaaaggattaatgaaaattgtcaaggcccttggagcggactttgga
gttgctcaggatggcgacgcagatagggccgtcttcatagatgaaaacgggcgcttcatc
caaggagacaagacgtttgccctcgttgctgatgccgtcctcagggaaagggggggtggc
ctgcttgtcactactgtggctacctctaacctgcttgatgatatagcgaagcgcaatggg
gctaaggttctcaggacgaaggtaggtgacctcgtggttgcaagggctctccttgagcac
gccggaacaataggcggcgaggagaacgggggcgtcatcttcccggaccacgttttggga
agggacggcgcgatgacggtagcgaaggtagtggagatattcgcgaagagcggcaagaag
ttcagtgagctcatcgatgagttgccaaagtattaccagataaagaccaagaggcacgtt
gagggcgacaggaaggcagttgttgcgaaagttggggaacttgcgaggagaaggggctac
aggatagacaccaccgatggcgttaaggtaatcttcgaggagggctgggttctcgtgaga
gccagcggaacggagccgataataaggattttcagcgaggccaagagtgaggagaaggcc
caagaatacctcgagctaggccttgagcttcttgagaaagcaatggagtaa

DBGET integrated database retrieval system