KEGG   Pyrococcus yayanosii: PYCH_07240Help
Entry
PYCH_07240        CDS       T01543                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pya  Pyrococcus yayanosii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PYCH_07240
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PYCH_07240
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PYCH_07240
Enzymes [BR:pya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PYCH_07240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(616521..617852)
Genome map
AA seq 443 aa AA seqDB search
MFTCPRCGREYSSVIPPFCVCGESLEIRYDYSAVDVRKWRRREKGVWRYKELLPPVRRIV
SLREGGTPFIKAKIGEKLGFDVFIKDETRNPTGSFRDRLATVSVSYGLPYAGNGFIVASD
GNAAASLAAYAARAGREAFVVVPKKVDKGKLAQMIAFGARIIRYGESVDECIEYAKELAK
LNGLYDVTPENNVIGLEGQKTIAFELWEEVNPTHVIVPTGSGSNIYSIYKGFRELFELDL
IGELPRLIAVQVDRCNPIAAEILGLKKNCGLTKALGLFVKEPVMKEGAVEAVKKSEGTAV
IVGEDELDLGERMLAAEGIFAEYASAVVMPALLKLAEDGYFERGDRVVLVVTGSGLKGWS
GERERFSIGGTKLEILRLLAEKEMYGYEIWASLERPLKYQAVYQHMRELEALGLVEVAFK
RGRRVYYRLTEKGRRLLENLEAP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttcacctgcccgaggtgcggcagggaatattcctctgtaattcctcccttttgcgtc
tgcggcgagtcccttgagattaggtacgactactcggccgtggacgtgcggaaatggagg
aggagagagaaaggagtatggcgctataaagaattgctgccccccgtaagaaggatcgtt
agcctaagagagggtgggaccccctttataaaggcgaaaataggcgagaaactgggattc
gacgtcttcataaaggatgagacaaggaaccccacgggttccttcagggacaggctggcc
acagtttcagtttcctatggcctcccatatgcgggaaacggcttcatagtggctagcgat
ggcaacgcggctgcatcccttgccgcttatgccgcaagggctgggagagaggccttcgtc
gtcgtccctaagaaggttgacaagggcaagctcgctcaaatgatagccttcggggcgagg
atcatccggtacggagagagcgtagacgagtgcatagagtacgcgaaggagctggcaaag
ctcaacggcctctatgatgttactcccgagaacaacgtgatcggactggagggccagaag
accatagcctttgagctctgggaagaggtaaacccgacgcacgttatcgttccgacgggg
agcgggagcaacatctactccatctacaaggggtttagggagctcttcgagctcgatctc
ataggagagctcccgaggctcatagcagttcaggttgacaggtgcaacccgatagcggcc
gagatccttggtctcaaaaagaactgtgggctaaccaaggccctcggcctcttcgtaaag
gagcccgtaatgaaggagggggcagttgaggccgtgaagaagagcgagggaaccgccgtc
atcgtgggtgaggatgaactcgacctgggcgagaggatgcttgcggccgaggggatattc
gccgagtacgcctccgcggtcgtcatgcccgccctcctgaagctagccgaggacgggtac
ttcgagaggggggacagggtcgtcctcgtcgtgacgggctctggccttaagggatggtct
ggggagagggaaaggttctccatagggggcacgaagctggagatattacgactccttgcc
gagaaggagatgtacggctacgaaatttgggcctctctggagaggcccctgaagtatcag
gccgtttatcagcacatgagggagcttgaggcccttggtctggtcgaggtcgccttcaaa
cgtggtaggagagtctattacaggctcacggagaagggaagaaggcttctggagaacctg
gaggcaccgtga

DBGET integrated database retrieval system