KEGG   Pyrococcus yayanosii: PYCH_07240Help
Entry
PYCH_07240        CDS       T01543                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pya  Pyrococcus yayanosii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PYCH_07240
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PYCH_07240
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PYCH_07240
Enzymes [BR:pya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PYCH_07240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(616521..617852)
Genome map
AA seq 443 aa AA seqDB search
MFTCPRCGREYSSVIPPFCVCGESLEIRYDYSAVDVRKWRRREKGVWRYKELLPPVRRIV
SLREGGTPFIKAKIGEKLGFDVFIKDETRNPTGSFRDRLATVSVSYGLPYAGNGFIVASD
GNAAASLAAYAARAGREAFVVVPKKVDKGKLAQMIAFGARIIRYGESVDECIEYAKELAK
LNGLYDVTPENNVIGLEGQKTIAFELWEEVNPTHVIVPTGSGSNIYSIYKGFRELFELDL
IGELPRLIAVQVDRCNPIAAEILGLKKNCGLTKALGLFVKEPVMKEGAVEAVKKSEGTAV
IVGEDELDLGERMLAAEGIFAEYASAVVMPALLKLAEDGYFERGDRVVLVVTGSGLKGWS
GERERFSIGGTKLEILRLLAEKEMYGYEIWASLERPLKYQAVYQHMRELEALGLVEVAFK
RGRRVYYRLTEKGRRLLENLEAP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttcacctgcccgaggtgcggcagggaatattcctctgtaattcctcccttttgcgtc
tgcggcgagtcccttgagattaggtacgactactcggccgtggacgtgcggaaatggagg
aggagagagaaaggagtatggcgctataaagaattgctgccccccgtaagaaggatcgtt
agcctaagagagggtgggaccccctttataaaggcgaaaataggcgagaaactgggattc
gacgtcttcataaaggatgagacaaggaaccccacgggttccttcagggacaggctggcc
acagtttcagtttcctatggcctcccatatgcgggaaacggcttcatagtggctagcgat
ggcaacgcggctgcatcccttgccgcttatgccgcaagggctgggagagaggccttcgtc
gtcgtccctaagaaggttgacaagggcaagctcgctcaaatgatagccttcggggcgagg
atcatccggtacggagagagcgtagacgagtgcatagagtacgcgaaggagctggcaaag
ctcaacggcctctatgatgttactcccgagaacaacgtgatcggactggagggccagaag
accatagcctttgagctctgggaagaggtaaacccgacgcacgttatcgttccgacgggg
agcgggagcaacatctactccatctacaaggggtttagggagctcttcgagctcgatctc
ataggagagctcccgaggctcatagcagttcaggttgacaggtgcaacccgatagcggcc
gagatccttggtctcaaaaagaactgtgggctaaccaaggccctcggcctcttcgtaaag
gagcccgtaatgaaggagggggcagttgaggccgtgaagaagagcgagggaaccgccgtc
atcgtgggtgaggatgaactcgacctgggcgagaggatgcttgcggccgaggggatattc
gccgagtacgcctccgcggtcgtcatgcccgccctcctgaagctagccgaggacgggtac
ttcgagaggggggacagggtcgtcctcgtcgtgacgggctctggccttaagggatggtct
ggggagagggaaaggttctccatagggggcacgaagctggagatattacgactccttgcc
gagaaggagatgtacggctacgaaatttgggcctctctggagaggcccctgaagtatcag
gccgtttatcagcacatgagggagcttgaggcccttggtctggtcgaggtcgccttcaaa
cgtggtaggagagtctattacaggctcacggagaagggaagaaggcttctggagaacctg
gaggcaccgtga

DBGET integrated database retrieval system