KEGG   Pyrococcus yayanosii: PYCH_07240Help
Entry
PYCH_07240        CDS       T01543                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pya  Pyrococcus yayanosii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pya01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pya00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pya00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(616521..617852)
Genome map
AA seq 443 aa AA seqDB search
MFTCPRCGREYSSVIPPFCVCGESLEIRYDYSAVDVRKWRRREKGVWRYKELLPPVRRIV
SLREGGTPFIKAKIGEKLGFDVFIKDETRNPTGSFRDRLATVSVSYGLPYAGNGFIVASD
GNAAASLAAYAARAGREAFVVVPKKVDKGKLAQMIAFGARIIRYGESVDECIEYAKELAK
LNGLYDVTPENNVIGLEGQKTIAFELWEEVNPTHVIVPTGSGSNIYSIYKGFRELFELDL
IGELPRLIAVQVDRCNPIAAEILGLKKNCGLTKALGLFVKEPVMKEGAVEAVKKSEGTAV
IVGEDELDLGERMLAAEGIFAEYASAVVMPALLKLAEDGYFERGDRVVLVVTGSGLKGWS
GERERFSIGGTKLEILRLLAEKEMYGYEIWASLERPLKYQAVYQHMRELEALGLVEVAFK
RGRRVYYRLTEKGRRLLENLEAP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttcacctgcccgaggtgcggcagggaatattcctctgtaattcctcccttttgcgtc
tgcggcgagtcccttgagattaggtacgactactcggccgtggacgtgcggaaatggagg
aggagagagaaaggagtatggcgctataaagaattgctgccccccgtaagaaggatcgtt
agcctaagagagggtgggaccccctttataaaggcgaaaataggcgagaaactgggattc
gacgtcttcataaaggatgagacaaggaaccccacgggttccttcagggacaggctggcc
acagtttcagtttcctatggcctcccatatgcgggaaacggcttcatagtggctagcgat
ggcaacgcggctgcatcccttgccgcttatgccgcaagggctgggagagaggccttcgtc
gtcgtccctaagaaggttgacaagggcaagctcgctcaaatgatagccttcggggcgagg
atcatccggtacggagagagcgtagacgagtgcatagagtacgcgaaggagctggcaaag
ctcaacggcctctatgatgttactcccgagaacaacgtgatcggactggagggccagaag
accatagcctttgagctctgggaagaggtaaacccgacgcacgttatcgttccgacgggg
agcgggagcaacatctactccatctacaaggggtttagggagctcttcgagctcgatctc
ataggagagctcccgaggctcatagcagttcaggttgacaggtgcaacccgatagcggcc
gagatccttggtctcaaaaagaactgtgggctaaccaaggccctcggcctcttcgtaaag
gagcccgtaatgaaggagggggcagttgaggccgtgaagaagagcgagggaaccgccgtc
atcgtgggtgaggatgaactcgacctgggcgagaggatgcttgcggccgaggggatattc
gccgagtacgcctccgcggtcgtcatgcccgccctcctgaagctagccgaggacgggtac
ttcgagaggggggacagggtcgtcctcgtcgtgacgggctctggccttaagggatggtct
ggggagagggaaaggttctccatagggggcacgaagctggagatattacgactccttgcc
gagaaggagatgtacggctacgaaatttgggcctctctggagaggcccctgaagtatcag
gccgtttatcagcacatgagggagcttgaggcccttggtctggtcgaggtcgccttcaaa
cgtggtaggagagtctattacaggctcacggagaagggaagaaggcttctggagaacctg
gaggcaccgtga

DBGET integrated database retrieval system