KEGG   Pyrococcus yayanosii: PYCH_07500Help
Entry
PYCH_07500        CDS       T01543                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pya  Pyrococcus yayanosii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PYCH_07500
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PYCH_07500
Enzymes [BR:pya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PYCH_07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642436..643362
Genome map
AA seq 308 aa AA seqDB search
MEWKGRDIISIRDFSKEDIEFVLETAERLERELREKGHLEYAKGKILATLFFEPSTRTRL
SFESAMHRLGGAVIGFAEASTTSVKKGESLRDTIKTVEQYSDVIVIRHPKEGAARLAAEV
AEIPVINAGDGSNQHPTQTLLDLYTIKKEFGRIDGLKIGLLGDLKYGRTTHSLAEALSFY
DVELYLISPELLRMPRHIVEELRERGVKVKETSDLEAVIGELDVLYVTRIQKERFPDEQE
YLKVKGSYQVNLAILAKAKENLKVMHPLPRVDEIHPEVDGTPHAIYFKQVFNGVPVRMAL
LGLVLGVI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaagggtagggacattataagcattagggacttctcgaaggaggacatagaa
ttcgttcttgagactgcagagaggcttgagagagagctcagggagaagggccacctcgaa
tacgcgaagggcaagatcctggcgacgctgttctttgaaccttcgacgaggacaaggctg
agcttcgagagtgccatgcataggctaggtggggcagttataggcttcgcagaggcttct
acgaccagtgtcaagaagggagaaagcttgagggacacgataaagaccgtggaacagtac
agtgacgtcatagtgataaggcaccccaaggagggtgccgcccgcttagcagcagaggtt
gccgaaatccccgttataaatgctggcgacggtagcaaccagcatccgacccagacgctc
ctcgacctctacacgattaagaaggagttcggccggatagacggtctcaagatcgggctc
ctcggagatctgaagtatggcaggaccacccacagcctcgccgaagcattgagcttctac
gacgttgagttgtacctgatatcgcccgagctcctcaggatgccgaggcatatagttgag
gagctccgcgagaggggcgttaaggttaaggagacgagcgaccttgaggctgtcataggc
gagctggacgtcctctacgtgacgaggattcagaaggagcgcttcccagacgagcaggag
tacctcaaggttaaggggagttaccaggtcaaccttgcgatcctcgcgaaggccaaagag
aacctgaaggtcatgcacccgctcccgagggttgatgagattcacccagaggtagatggg
acaccacacgcgatatacttcaagcaggtcttcaacggtgtccctgttaggatggccctc
ctcgggctcgttctgggggtgatttga

DBGET integrated database retrieval system