KEGG   Pyrococcus yayanosii: PYCH_13930Help
Entry
PYCH_13930        CDS       T01543                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pya  Pyrococcus yayanosii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PYCH_13930
   01230 Biosynthesis of amino acids
    PYCH_13930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_13930
   00051 Fructose and mannose metabolism
    PYCH_13930
   00562 Inositol phosphate metabolism
    PYCH_13930
Enzymes [BR:pya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PYCH_13930
Exosome [BR:pya04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PYCH_13930
  Exosomal proteins of bladder cancer cells
   PYCH_13930
  Exosomal proteins of melanoma cells
   PYCH_13930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1220947..1221624
Genome map
AA seq 225 aa AA seqDB search
MSLKEPIIVINFKTYIEATGKRALEIAKAAERVHKETGITIVVAPQLADLRMIAESVEIP
VFAQHIDPIKPGSHTGHVLPEAVKEAGAAGTLLNHSENRMILADLEAAIRRAEEVGLITI
VCSNNPAVSAAVAALDPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKRVNPKVKVLC
GAGITTGEDVKRALELGTVGVLLASGVTKAKDPEKAIWDLVSKII
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagcctaaaggagccgattatcgtgattaactttaagacttatatcgaggccactgga
aagagggcccttgagatagccaaggccgccgagagggtccacaaggagactgggataaca
atcgtggtagccccgcaactggccgacctcaggatgatagcggagagcgtcgaaattcca
gtctttgcccagcacatagatccgattaagcccggcagccacactggccacgtcctccca
gaggctgtcaaagaggccggggctgcgggaacgctcctcaaccactcggagaacaggatg
attttggcggacctcgaggcggctataaggagggcagaggaagttggcctaataacgatt
gtctgctccaacaacccggccgtttcagcggctgttgcagcgctcgatccggactacgtg
gcagttgaaccgcctgagcttataggcaccggcattccggtcagcaaggccaagccggaa
gttatcaccgatacggtcgagctcgtgaagagggtgaaccctaaagtcaaggtgctctgc
ggggctggaataaccacaggtgaggacgtcaagagggctctggagctgggaaccgttgga
gttcttctggccagcggtgttaccaaggcgaaagaccctgaaaaggcaatctgggacctc
gtctccaagataatctaa

DBGET integrated database retrieval system