KEGG   Pyrococcus yayanosii: PYCH_13930Help
Entry
PYCH_13930        CDS       T01543                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00010  Glycolysis / Gluconeogenesis
pya00051  Fructose and mannose metabolism
pya00562  Inositol phosphate metabolism
pya01100  Metabolic pathways
pya01110  Biosynthesis of secondary metabolites
pya01120  Microbial metabolism in diverse environments
pya01130  Biosynthesis of antibiotics
pya01200  Carbon metabolism
pya01230  Biosynthesis of amino acids
Module
pya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pya_M00002  Glycolysis, core module involving three-carbon compounds
pya_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_13930
   00051 Fructose and mannose metabolism
    PYCH_13930
   00562 Inositol phosphate metabolism
    PYCH_13930
Enzymes [BR:pya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PYCH_13930
Exosome [BR:pya04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PYCH_13930
  Exosomal proteins of bladder cancer cells
   PYCH_13930
  Exosomal proteins of melanoma cells
   PYCH_13930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS B12-binding His_biosynth NMO DHO_dh
Motif
Other DBs
NCBI-ProteinID: AEH25063
UniProt: F8AG09
Position
1220947..1221624
Genome map
AA seq 225 aa AA seqDB search
MSLKEPIIVINFKTYIEATGKRALEIAKAAERVHKETGITIVVAPQLADLRMIAESVEIP
VFAQHIDPIKPGSHTGHVLPEAVKEAGAAGTLLNHSENRMILADLEAAIRRAEEVGLITI
VCSNNPAVSAAVAALDPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKRVNPKVKVLC
GAGITTGEDVKRALELGTVGVLLASGVTKAKDPEKAIWDLVSKII
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagcctaaaggagccgattatcgtgattaactttaagacttatatcgaggccactgga
aagagggcccttgagatagccaaggccgccgagagggtccacaaggagactgggataaca
atcgtggtagccccgcaactggccgacctcaggatgatagcggagagcgtcgaaattcca
gtctttgcccagcacatagatccgattaagcccggcagccacactggccacgtcctccca
gaggctgtcaaagaggccggggctgcgggaacgctcctcaaccactcggagaacaggatg
attttggcggacctcgaggcggctataaggagggcagaggaagttggcctaataacgatt
gtctgctccaacaacccggccgtttcagcggctgttgcagcgctcgatccggactacgtg
gcagttgaaccgcctgagcttataggcaccggcattccggtcagcaaggccaagccggaa
gttatcaccgatacggtcgagctcgtgaagagggtgaaccctaaagtcaaggtgctctgc
ggggctggaataaccacaggtgaggacgtcaagagggctctggagctgggaaccgttgga
gttcttctggccagcggtgttaccaaggcgaaagaccctgaaaaggcaatctgggacctc
gtctccaagataatctaa

DBGET integrated database retrieval system