KEGG   Pyrococcus yayanosii: PYCH_13990Help
Entry
PYCH_13990        CDS       T01543                                 

Definition
histone acetyltransferase Elp3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pya  Pyrococcus yayanosii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1226081..1227850)
Genome map
AA seq 589 aa AA seqDB search
MGEFESALREIVNALLQGKVRDREELNRLKVEVSRRYHLPRLPKNSEIWRALPDNVREKF
RELLKKKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSVGSPQSYTGKEPSALRASQY
GYHPYIIMMARLKQLYDIGHPVDKVEVIIQGGTFLAVDLDYQEWFIKEAFKAMNDFPYFR
DIENLEEKLVRLIIEGDASVLEEDPAFRRAWGRTHRRRYYYLEDEQRKNERAKVRMVGLT
IETRPDWAFEKQIDRMLALGTTRVELGVQTVFNFIYERVRRGHTVEDVVRATQLLKDAGL
KVNYHIMPGLPGSNFERDLRAFRMIFEDERFRPDMLKIYPTLVTADAPLYAWYKAGKYRP
YTTEEAVELLVEVYKILPKWVRVMRIQRDIPSNLIVAGVKHSNLGQLVFNELIKRGIRPR
EIRFREVGHQMQKFGIQPDPDHIELLREDYEASEGQEIFLSFEDTKNDILIGFLRLRIPS
EKAHRREINCCPSAIVRELHIYGPLVPIGEKPKYEWQHRGYGRELLAEAERTAREEFDVK
KMLVISGVGVREYYRKFGYRKDGPYVSKRLDRGYANFGKSEEFDAHLNT
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggagagtttgaaagcgcattgagagagatagtcaacgccctgcttcagggtaaggtg
agggatagggaggagctcaacaggttaaaggttgaggtttcacgcaggtatcatcttcca
aggttgcctaagaactcggaaatatggagagcccttccagataacgttagggagaagttt
agggagttacttaagaaaaagccaacgagaacgataagcggggttgctgtagttgccatg
atgacaaagccgttcccctgcccccatggaaggtgcatttattgtccagggggacctagc
gttggttccccccaaagttatactgggaaggaaccttccgccttaagagcctcacagtac
gggtatcatccgtacatcataatgatggctcggctaaagcaactctatgacataggtcat
cccgtggataaggtggaggtaataattcagggaggcacattcctggccgtcgacttggat
taccaggagtggttcataaaggaggcgttcaaggccatgaacgactttccttacttccgg
gacatcgagaaccttgaggagaagctggtgaggctgataatcgaaggggatgcctccgtt
cttgaggaagatccggctttcaggagggcctgggggaggacgcatagaaggcggtactat
taccttgaggacgagcagaggaagaacgagagggccaaagtcaggatggtgggtttaaca
atcgaaactcgaccagactgggcctttgagaagcagatcgacaggatgttggcccttggt
actacaagggtggagctgggtgttcagacggtctttaacttcatctacgagcgggttaga
agggggcacacagtcgaggacgtcgtgagggccacgcagctgcttaaggacgcgggcctc
aaggtgaattaccatataatgccgggccttccggggagcaacttcgagcgcgatctgagg
gccttccgcatgatctttgaggatgagagattcaggcccgacatgctgaagatatatccg
accctcgtcacggcagatgcccccctctacgcttggtataaggcgggcaagtacagaccc
tacacgaccgaagaagccgtagagctcctcgtggaggtttacaaaatcctgcccaagtgg
gttcgtgttatgagaatccagagggatatcccctctaacctaatagtcgcgggcgtcaag
cactcaaaccttggccagctcgtcttcaacgagcttatcaagaggggcataaggccgagg
gaaataaggttcagggaagttggccatcagatgcagaagtttggtattcagcctgatccc
gatcacatagagctcctccgcgaagactacgaggcaagcgagggccaggaaatcttcctc
agctttgaggacacgaagaacgacattctcataggctttctacgtcttagaataccgagc
gagaaggcccaccgtagagagattaactgctgcccctcggccatagtaagagagctccac
atttacggcccgctcgttccgataggggagaagccgaagtacgagtggcagcatcgtggc
tatggtcgggagctcttggccgaggcggagaggacagcgagggaggagttcgacgtcaag
aagatgctcgtcataagtggcgtgggcgtcagggaatattacaggaagttcggctaccgg
aaggacgggccttatgtcagcaagaggctcgacagagggtatgcaaactttggaaaaagc
gaggagttcgacgctcatttaaacacgtga

DBGET integrated database retrieval system