KEGG   Pyrococcus yayanosii: PYCH_15440Help
Entry
PYCH_15440        CDS       T01543                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pya  Pyrococcus yayanosii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pya00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PYCH_15440
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PYCH_15440
Enzymes [BR:pya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PYCH_15440
Two-component system [BR:pya02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PYCH_15440
Bacterial motility proteins [BR:pya02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PYCH_15440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1350641..1351750
Genome map
AA seq 369 aa AA seqDB search
MPLGQRKIRVLVVDDSAFMRKILRDIINSDPELEVCCEARDGIEAIEMVRQHRPDVITLD
VEMPRMNGLDALRVIMNKYPTPVIMISALTQEGAEATIKALEYGAIDFIPKPSSSISINM
KEMKDEIIAKIKEAARVPRRFLELKRVRLLRVQKAKRMKPSVPARVAVAIAASTGGPQSL
LKIFPKFPENLKAGILLVQHMPPGFTRSFAKRLDNVSKIDVKEAEEGDVVEEGKAYVAPG
DYHMEVTLRNGKPVITLNKKPKIHGVRPAADPMMISAANVFGRKTVGVVMTGMGRDGAQG
IVAIKKKGGITIAQDKETSIIFGMPKAAIETGMVDYIVPLDKIPETVVTAVEKVWRGGGG
GGRPFSISR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcccctagggcagcggaaaattagggtcctcgtggttgatgattcagccttcatgaga
aaaatccttcgagatataataaactccgatcctgagctggaggtctgctgcgaggcccga
gatggcatagaggctatagaaatggttagacaacaccgaccagacgtcataacacttgac
gtagaaatgcccagaatgaacggcctcgatgccttgagggtcatcatgaacaaatatcca
acccccgtcataatgataagcgccctaacacaggagggagctgaggccacgattaaggcc
cttgaatatggggccatagacttcattcccaagccctcctcctcaatctcaataaacatg
aaagaaatgaaagatgaaataatcgccaagataaaggaggccgcccgcgttccaaggagg
tttcttgagctaaagcgagttaggcttcttcgcgtccagaaggccaagagaatgaaaccc
tcagttccagctagggtcgcagtagccatagcggcttcaactggtggcccccaatcactt
ctcaagatattccccaagttccccgagaatctaaaggctggtatccttctcgtccagcac
atgccgcccggcttcacccgctccttcgccaagaggctcgataatgtctccaaaatagat
gtcaaggaggccgaagagggggacgttgtggaggaaggaaaggcctatgtggcccccggc
gattaccacatggaagtgaccctgaggaatggtaagcctgttataactctcaataagaag
cctaagatacacggcgtcagaccagcggcagatcctatgatgatatccgcggccaatgtt
tttggtaggaagaccgtgggggtagtgatgacgggtatggggcgcgacggagcccaggga
atagttgccatcaagaagaaaggtgggataacgatagcacaggacaaagaaacctctata
atcttcgggatgcccaaggccgcgatagagaccggtatggttgactatattgttcctcta
gataaaatcccagagaccgtggtcacggcagtcgagaaggtgtggcgagggggtggaggc
ggtggaagacctttctcaatatctcgatga

DBGET integrated database retrieval system