KEGG   Pyrococcus yayanosii: PYCH_16440Help
Entry
PYCH_16440        CDS       T01543                                 

Definition
L-fuculose 1-phosphate aldolase (fucA)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pya  Pyrococcus yayanosii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PYCH_16440
Enzymes [BR:pya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PYCH_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1454839..1455402
Genome map
AA seq 187 aa AA seqDB search
MRNVKRALVKYSRLAHTKGLTGSFGGNISVRVRDMVFIKGTGAVMGELTEGQVAILKLDG
RQVSAVRPSSEWRLHLSVYKVRPDVRAVVHLHPPYSIAVSILVKGELPLLTPEAELYLGR
VPVLPFRPAGSGELAEIVAGGLRRADAVLMERHGIVTVGKSLREAFYRAELVEESARLWF
ETRNRRF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaacgtgaagagggctctcgttaagtactcgaggctggcccacaccaaaggacta
acaggttccttcggtggtaacataagcgtccgcgtccgtgacatggtcttcataaaggga
acgggggctgtgatgggggagctgacggagggccaagtggcaatcctgaagctcgacggg
aggcaggtttcggccgtgaggccctcttcggaatggagactccacttgagcgtttacaag
gtaaggcctgatgtgagggcggtggttcaccttcatcccccctactccatagcggtttcc
atactcgtgaaaggggagcttccactcctgactcccgaggccgagctctaccttggaagg
gttcccgtcctccccttcaggccggccgggagtggggagctcgctgagattgtcgccggg
gggctgaggagagcagacgctgtcctgatggagaggcacggaatagtgacggttgggaag
agccttagggaggcgttctatagggcagagctcgtggaggagagcgctcgcctctggttc
gaaactcggaacagaaggttttaa

DBGET integrated database retrieval system