KEGG   Pyrococcus yayanosii: PYCH_17670Help
Entry
PYCH_17670        CDS       T01543                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase (galU)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00040  Pentose and glucuronate interconversions
pya00052  Galactose metabolism
pya00500  Starch and sucrose metabolism
pya00520  Amino sugar and nucleotide sugar metabolism
pya01100  Metabolic pathways
pya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PYCH_17670
   00052 Galactose metabolism
    PYCH_17670
   00500 Starch and sucrose metabolism
    PYCH_17670
   00520 Amino sugar and nucleotide sugar metabolism
    PYCH_17670
Enzymes [BR:pya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PYCH_17670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: AEH25426
UniProt: F8AHP8
Position
1580448..1581308
Genome map
AA seq 286 aa AA seqDB search
MRIRKAVIPAAGLGTRMLPITKSMPKEMLPIVDKPVIHYVVEEAIKAGIDDILIITGKGK
RTIEDYFDRSFELEYYLREKGKLDELRQVEEIGEMIDIYYVRQKKPLGLGDAILHAEKHV
NGEPFAVLLGDDIIVSEKPGIGQLIEVTQKKNAPIIGVEKVPWDRVSRYGIIKGKEIGKG
LYTVEDLIEKPSPNEAPSNIAIIGRYILPPEIFDVLKETPPGKDGEIQLTDALRLLVKDT
NLLAKEIEGRRYDVGDKVEFIIANLELGLVRKDVRKHILEYLERFK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgaggattaggaaggcggttattcccgctgccggccttggaacgaggatgcttccaata
accaagtcaatgcccaaggaaatgctcccaatagtggacaagcctgttattcattatgtt
gttgaagaagcaataaaagctggaatcgatgacattttaataattaccggaaaggggaag
cgcactatagaggactattttgacaggagttttgagctggagtactatctcagagagaag
ggcaagcttgatgagcttaggcaggttgaggagattggagagatgattgatatttactac
gtgagacaaaagaagcctcttgggcttggagatgccatactacatgcagagaaacacgtt
aacggtgaacccttcgcagtcctcctgggcgatgacataatcgtgagcgagaaacctgga
atagggcagttgatagaagttacccagaagaagaacgctcctatcataggcgttgagaag
gtgccctgggatagggtaagcaggtatgggataatcaagggcaaggaaatcggaaaaggc
ctttacacggtggaggatctaatagagaagccctcccccaacgaagccccgagtaacatt
gcaataattggtaggtatattttgcctccagaaatcttcgatgtattaaaggaaacacct
cctggtaaggatggagagatacagctcacggatgcccttagactcttggtgaaggatact
aatcttcttgctaaagaaattgagggcaggagatatgatgttggtgacaaggtagaattc
ataatagcaaaccttgagctgggcttggtgagaaaagatgttcggaaacatatactggag
tacctggaaagatttaagtga

DBGET integrated database retrieval system