KEGG   Pyrococcus yayanosii: PYCH_17670Help
Entry
PYCH_17670        CDS       T01543                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pya  Pyrococcus yayanosii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PYCH_17670
   00052 Galactose metabolism
    PYCH_17670
   00500 Starch and sucrose metabolism
    PYCH_17670
   00520 Amino sugar and nucleotide sugar metabolism
    PYCH_17670
Enzymes [BR:pya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PYCH_17670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1580448..1581308
Genome map
AA seq 286 aa AA seqDB search
MRIRKAVIPAAGLGTRMLPITKSMPKEMLPIVDKPVIHYVVEEAIKAGIDDILIITGKGK
RTIEDYFDRSFELEYYLREKGKLDELRQVEEIGEMIDIYYVRQKKPLGLGDAILHAEKHV
NGEPFAVLLGDDIIVSEKPGIGQLIEVTQKKNAPIIGVEKVPWDRVSRYGIIKGKEIGKG
LYTVEDLIEKPSPNEAPSNIAIIGRYILPPEIFDVLKETPPGKDGEIQLTDALRLLVKDT
NLLAKEIEGRRYDVGDKVEFIIANLELGLVRKDVRKHILEYLERFK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgaggattaggaaggcggttattcccgctgccggccttggaacgaggatgcttccaata
accaagtcaatgcccaaggaaatgctcccaatagtggacaagcctgttattcattatgtt
gttgaagaagcaataaaagctggaatcgatgacattttaataattaccggaaaggggaag
cgcactatagaggactattttgacaggagttttgagctggagtactatctcagagagaag
ggcaagcttgatgagcttaggcaggttgaggagattggagagatgattgatatttactac
gtgagacaaaagaagcctcttgggcttggagatgccatactacatgcagagaaacacgtt
aacggtgaacccttcgcagtcctcctgggcgatgacataatcgtgagcgagaaacctgga
atagggcagttgatagaagttacccagaagaagaacgctcctatcataggcgttgagaag
gtgccctgggatagggtaagcaggtatgggataatcaagggcaaggaaatcggaaaaggc
ctttacacggtggaggatctaatagagaagccctcccccaacgaagccccgagtaacatt
gcaataattggtaggtatattttgcctccagaaatcttcgatgtattaaaggaaacacct
cctggtaaggatggagagatacagctcacggatgcccttagactcttggtgaaggatact
aatcttcttgctaaagaaattgagggcaggagatatgatgttggtgacaaggtagaattc
ataatagcaaaccttgagctgggcttggtgagaaaagatgttcggaaacatatactggag
tacctggaaagatttaagtga

DBGET integrated database retrieval system