KEGG   Pyrococcus yayanosii: PYCH_18320Help
Entry
PYCH_18320        CDS       T01543                                 

Definition
Glycerol kinase (glpK)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pya  Pyrococcus yayanosii
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PYCH_18320
Enzymes [BR:pya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PYCH_18320
Exosome [BR:pya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PYCH_18320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1634302..1635783
Genome map
AA seq 493 aa AA seqDB search
MEKFVLSLDEGTTSARAIIFDRNSEILGFGQYEFPQHYPRPGWVEHDPEEIWDAQLRAIK
TALEMAKVEPSQIAAIGVTNQRETTIVWDRKGKPLYNAIVWQCRRTAEIVEEIKKEYGDV
IKEKTGLVPDAYFSASKLKWVLDNVPGLRERAEKGEVMFGTVDTFLIYRLTGEHITDYSN
ASRTMLFNIKKLEWDEELLEIFGIPESILPEVRESSEVYGYTKKELLGAEIPVSGDAGDQ
QAALFGQAAFEEGTVKATYGTGNFILANTGRMILYSDNLLTTIAWGLDGKVTYALEGSVF
ITGAAVQWLRDGIEIIKSASETEELATKLASNEGVYFVPAFVGLGAPYWDQFARGLIIGI
TRGTSREHFARATLEAIAYLTRDVIEEMERLISIKELRVDGGATANNFLMQFQADILNKR
VIRPVVKETTALGAAYLAGLAVDYWESLDEIRALWRAERVFEPSMDEETRERLYRGWKEA
VKRAMGWAKIVAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtttgtgctctccctagatgaaggaaccacatcagcaagggctataatcttc
gacaggaacagtgagattctcggctttggacagtacgagttcccccagcactaccccagg
cccggctgggtggagcacgaccctgaggaaatctgggacgcacagctcagggccataaaa
acggcgcttgagatggccaaggtggagcctagtcagatagcggcaattggagtcacaaac
cagcgcgagacgacaatagtctgggacaggaaaggaaaacccctctacaacgccatagtc
tggcagtgcaggaggacggccgaaatcgtcgaggagataaagaaggaatacggcgacgtt
atcaaagagaagactggcctcgttcccgacgcctacttttcggcgagcaagcttaagtgg
gtcctcgacaacgttcccggccttagggagagggccgagaagggcgaggtcatgttcgga
acggttgatacgttcctcatctaccgcctcacgggcgagcacataacggactattcgaac
gcgtccagaacaatgctcttcaacatcaaaaagctggagtgggacgaggagctcctagaa
atcttcggaattcctgagagcattctgccagaggttagggagtcgagcgaggtttacggc
tacactaagaaggaacttttaggggccgaaatccctgtgagcggagacgccggcgaccag
caggcggcactttttggccaggccgccttcgaggagggcacggttaaggccacctacgga
accggcaactttatcttagcgaacactggcaggatgatactttactcagacaacctcctc
acgacgatagcctggggactggacggaaaggtaacctacgccctcgagggtagcgtgttc
attacgggcgccgccgtccagtggctccgcgatgggattgagataatcaagagtgcttcc
gagacggaagaattggctacaaagctcgcctcaaatgaaggcgtctacttcgttccagcg
tttgtgggcctcggtgctccttactgggaccagtttgcgaggggcttgataatcggcata
acgcgtggaacgagcagggagcatttcgcgagggcaacgctcgaggcgatagcctatctg
acgagggacgtcatcgaggaaatggagaggcttatctccattaaggagctccgcgttgat
ggaggggcaaccgcgaacaacttcctcatgcagttccaagctgacatcctgaacaagagg
gtgataaggcccgtcgtgaaggaaacaacagcccttggagccgcctacctggcgggtctc
gccgttgactactgggagagcttggatgagataagggcactctggagggccgagagggtc
ttcgagccgagcatggatgaggaaacgagggaaagactataccgcggatggaaggaggcc
gtgaagagggcaatgggctgggcgaaaatcgtggcggcttga

DBGET integrated database retrieval system