KEGG   Pyrococcus yayanosii: PYCH_18690Help
Entry
PYCH_18690        CDS       T01543                                 

Definition
tungsten-containing glyceraldehyde-3-phosphate:ferredoxin
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pya  Pyrococcus yayanosii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PYCH_18690
   01230 Biosynthesis of amino acids
    PYCH_18690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYCH_18690
Enzymes [BR:pya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     PYCH_18690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667853..1669823
Genome map
AA seq 656 aa AA seqDB search
MAMRFRVLKLDVGKREISTEDFEKEDVFGIIDYGIHLHSEVYKSYEVEPYDPRNIVVFGK
GPFAGSALPGSHRLMFFFRSPLYGVLMPSAMGGAAYQFQHVGVDFVVVEGRAEKPTVVVL
KNDGERLEVNLLQMELDKVIEIWRGYKGEEGVYALTQYLLDTLGKEFEGMKFRIAVVGPA
ALNTNYGAIFSQALRNGKRMVGSEDWAARGGPGSVLLRAHNVVAIAFGGKPRKKAFPGED
IGSFKTAKGIVEGVHKKPYNEVVSEKTVKYRFNPKLNTGGTFGGNYPAEGDLVPILNWQM
PYIPKEDRIRIHENIMKHYWGPFNEEAIKTKNWTTCGEPCPVVCKKHRRGHHVEYEPYEA
NGPLSGSISLRASDISVHAVDAMGFDAIEFGGTAAWILELVHRGLLKPEEVGLSGKPEFT
KEALLEKPVETSEVNAKLVAELAHRVAFAENEIAKIIGLGKRKASRILDEKFKDRLAYGE
SFKDYGVFVPLGEDGEITPTMYWAIGNYIPLPIQGRYWTFYQFGVFLEPEELAQKIVASA
IWEFWYDNVGWCRFHRGWMKPVLKVLFMEAYGVNVDMEEHAKKQMRKLIEYAKKAGYEPV
FWDSMRVIDLVAAGAEEFGNEAWAERFKADKIGTAKEYLKRVLRTYSQLLGVEWEI
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagatttcgggtgcttaagctcgacgtcggtaagagggaaatctcaacggaa
gacttcgagaaggaagacgtcttcggaatcattgactatggaatccacctccactcagag
gtttacaagagctacgaggtcgagccctatgacccaaggaacatcgttgtgttcggtaag
ggaccctttgccggctccgcgctccccgggtcccacaggcttatgttcttcttccgatca
cctctctacggtgtccttatgccctcggcgatgggaggggccgcgtaccagttccagcac
gttggagtggacttcgtggtcgtggaggggagggcggagaagcccaccgtcgtcgtgctc
aagaacgatggtgagaggctcgaggtgaaccttcttcagatggagcttgataaggtcatc
gagatttggagaggttacaagggtgaagaaggtgtctatgcactcacccaatacctcctc
gacaccttaggaaaggagttcgagggaatgaaattcaggattgccgtcgtggggcccgcg
gccctcaacacaaactacggagccatattttctcaggcgctgaggaacggaaagcgtatg
gttggaagcgaggactgggcggcacgcggcggtcccggtagcgttctgctaagagctcat
aatgtcgttgcaatagccttcggtggaaagccgaggaagaaggccttcccaggggaggac
atcgggagcttcaagaccgccaaaggcatagtggagggcgtccacaagaagccctacaac
gaggtcgtgagcgagaagaccgtcaagtacaggttcaatcccaagcttaacacgggggga
accttcggcggcaactatccggccgagggcgacctcgtgcccatcctgaactggcaaatg
ccttacatcccgaaggaggaccgcataaggattcatgaaaacataatgaagcactactgg
gggcccttcaacgaggaggccatcaaaaccaagaattggacgacctgcggtgagccttgt
ccggtcgtgtgtaagaagcaccgtaggggccatcacgtcgagtacgagccttacgaggcc
aacggtccactgagcggaagcataagcctaagggcgagcgacataagcgtccacgccgtt
gacgccatgggctttgatgccatagagttcggaggaaccgccgcttggatccttgagctg
gtccacagaggcctgcttaagcccgaagaggtgggtctaagtgggaagccagagttcacc
aaagaggccctgctcgagaagcccgtcgagaccagcgaggtgaacgcgaagctcgtggcc
gagttagctcacagggttgccttcgccgaaaacgagatagctaagataatcggacttggc
aagaggaaggccagcaggatactcgatgagaagttcaaggacagactcgcctacggggaa
agcttcaaggactacggcgtctttgtgccgctgggagaggatggtgagataactccaacg
atgtactgggccataggcaactacataccactcccgattcagggtcggtactggacgttt
tatcaattcggcgtcttccttgagcccgaggagctggcccagaagatagtggcgagcgct
atttgggagttctggtatgacaacgtcgggtggtgtagattccacaggggatggatgaag
cccgttttgaaggtcctcttcatggaggcatacggcgtcaacgtggatatggaagagcac
gcgaagaagcagatgaggaagctcatagagtacgccaagaaggctggctacgagcccgtg
ttctgggattccatgagggtcatagacctcgtggctgccggcgccgaggagttcggcaat
gaggcgtgggccgagcgctttaaggccgacaagattggaaccgccaaggaatacctgaag
agggtcctcaggacctacagccagctactgggtgttgagtgggagatttaa

DBGET integrated database retrieval system