KEGG   Pyrococcus sp. NA2: PNA2_0111Help
Entry
PNA2_0111         CDS       T01487                                 

Definition
aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pyn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(98159..99205)
Genome map
AA seq 348 aa AA seqDB search
MVNYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVIAHRKGNGPKVMI
AAHMDQIGLMVTNIEKNGFLRVAPIGGVDPKTLIAQRFKVWIDKGKFIYGVGASVPPHIQ
KPEERKKAPDWDQIFIDIGAESKEEAEEMGVKIGTVITWDGRLERLGKHRFVSIAFDDRI
AVYTMLEVARQLEDTKADVYFVATVQEEVGLRGARTSAFALEPDYGFAIDVTIAADVPGT
PEHKQVTHLGKGTAIKIMDRSVICHPTIVRWLEELAKKYEIPYQLEILLGGGTDAGAIHL
TKAGVPTGALSVPARYIHSNAEVVDERDVDATVKLMVKALENIHELKI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtcaattatgagcttttaaagaaggttgttgaggccccaggtgtttccggatatgaa
ttcttgggcattagagacgtcgtaatagaggagataaaggattacgtcgatgaggtaaag
gtggacaagctaggaaatgtcatagcccataggaaaggaaatgggccgaaagttatgata
gcagctcacatggatcagataggtttaatggtgactaacatagaaaagaatggatttcta
agggttgctccaattggaggtgttgatccaaagacgctgatagctcagagatttaaggtg
tggatagacaaaggtaagttcatctatggagttggagcatccgttcctccgcacattcaa
aaacctgaggagagaaagaaggccccagattgggatcagatattcattgacattggtgca
gaaagtaaggaagaagctgaggagatgggagtaaagataggaactgtaattacctgggac
ggcagacttgaaagattaggaaaacacaggttcgttagcatagcctttgatgacaggatc
gccgtgtacacgatgttggaagttgcaagacagttggaagataccaaggcagacgtttac
tttgtggcaacggttcaggaggaagttgggttaagaggagcaagaacctcagcctttgca
ctcgagcccgattacggtttcgcaatagatgtgaccatagcagctgacgtcccgggaact
cccgagcacaagcaggtaactcatctaggaaagggcaccgcgataaagataatggatcgc
tccgtgatatgtcatccaaccatagtgagatggcttgaggagttagccaagaagtatgaa
atcccataccaactcgaaatactcctgggtggaggaacagatgctggggctattcactta
acgaaggcaggagttccaactggagcattgagcgttcctgcaaggtacatacattcaaat
gccgaagtcgtcgacgagagagacgtagatgcaaccgtcaagttaatggttaaggctctc
gagaacatccatgagcttaagatctaa

DBGET integrated database retrieval system