KEGG   Pyrococcus sp. NA2: PNA2_0111Help
Entry
PNA2_0111         CDS       T01487                                 

Definition
(GenBank) aminopeptidase
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
pyn  Pyrococcus sp. NA2
Brite
Enzymes [BR:pyn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     PNA2_0111
Peptidases [BR:pyn01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   PNA2_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(98159..99205)
Genome map
AA seq 348 aa AA seqDB search
MVNYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVIAHRKGNGPKVMI
AAHMDQIGLMVTNIEKNGFLRVAPIGGVDPKTLIAQRFKVWIDKGKFIYGVGASVPPHIQ
KPEERKKAPDWDQIFIDIGAESKEEAEEMGVKIGTVITWDGRLERLGKHRFVSIAFDDRI
AVYTMLEVARQLEDTKADVYFVATVQEEVGLRGARTSAFALEPDYGFAIDVTIAADVPGT
PEHKQVTHLGKGTAIKIMDRSVICHPTIVRWLEELAKKYEIPYQLEILLGGGTDAGAIHL
TKAGVPTGALSVPARYIHSNAEVVDERDVDATVKLMVKALENIHELKI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtcaattatgagcttttaaagaaggttgttgaggccccaggtgtttccggatatgaa
ttcttgggcattagagacgtcgtaatagaggagataaaggattacgtcgatgaggtaaag
gtggacaagctaggaaatgtcatagcccataggaaaggaaatgggccgaaagttatgata
gcagctcacatggatcagataggtttaatggtgactaacatagaaaagaatggatttcta
agggttgctccaattggaggtgttgatccaaagacgctgatagctcagagatttaaggtg
tggatagacaaaggtaagttcatctatggagttggagcatccgttcctccgcacattcaa
aaacctgaggagagaaagaaggccccagattgggatcagatattcattgacattggtgca
gaaagtaaggaagaagctgaggagatgggagtaaagataggaactgtaattacctgggac
ggcagacttgaaagattaggaaaacacaggttcgttagcatagcctttgatgacaggatc
gccgtgtacacgatgttggaagttgcaagacagttggaagataccaaggcagacgtttac
tttgtggcaacggttcaggaggaagttgggttaagaggagcaagaacctcagcctttgca
ctcgagcccgattacggtttcgcaatagatgtgaccatagcagctgacgtcccgggaact
cccgagcacaagcaggtaactcatctaggaaagggcaccgcgataaagataatggatcgc
tccgtgatatgtcatccaaccatagtgagatggcttgaggagttagccaagaagtatgaa
atcccataccaactcgaaatactcctgggtggaggaacagatgctggggctattcactta
acgaaggcaggagttccaactggagcattgagcgttcctgcaaggtacatacattcaaat
gccgaagtcgtcgacgagagagacgtagatgcaaccgtcaagttaatggttaaggctctc
gagaacatccatgagcttaagatctaa

DBGET integrated database retrieval system